BLASTX nr result
ID: Jatropha_contig00000503
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000503 (600 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabac... 108 1e-21 ref|XP_006301510.1| hypothetical protein CARUB_v10021936mg, part... 66 6e-09 >ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabacum] gi|56806549|dbj|BAD83450.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 108 Score = 108 bits (269), Expect = 1e-21 Identities = 55/65 (84%), Positives = 56/65 (86%) Frame = +1 Query: 406 LGEEGISIAKDSDSIQPQVPLRLHCYDFTPVEDPTVVCANKTTKSLCSTSGTQKSWVIVG 585 LGEE ISIAKDS IQPQVPLRL CYDFTPVEDPTVVCANKTTK LC TS QKSWVI+G Sbjct: 40 LGEECISIAKDS--IQPQVPLRLPCYDFTPVEDPTVVCANKTTKGLCGTSVPQKSWVIIG 97 Query: 586 PMLWA 600 PML A Sbjct: 98 PMLRA 102 >ref|XP_006301510.1| hypothetical protein CARUB_v10021936mg, partial [Capsella rubella] gi|482570220|gb|EOA34408.1| hypothetical protein CARUB_v10021936mg, partial [Capsella rubella] Length = 72 Score = 66.2 bits (160), Expect = 6e-09 Identities = 31/38 (81%), Positives = 32/38 (84%) Frame = +1 Query: 442 DSIQPQVPLRLHCYDFTPVEDPTVVCANKTTKSLCSTS 555 DSIQPQVPL L CY+FT VEDP VVCANKT KSLC TS Sbjct: 35 DSIQPQVPLWLPCYEFTRVEDPIVVCANKTIKSLCGTS 72