BLASTX nr result
ID: Jatropha_contig00000403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000403 (388 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002300664.1| predicted protein [Populus trichocarpa] gi|2... 71 2e-10 ref|XP_002529806.1| Flavin-containing amine oxidase domain-conta... 58 1e-06 >ref|XP_002300664.1| predicted protein [Populus trichocarpa] gi|222842390|gb|EEE79937.1| amine oxidase family protein [Populus trichocarpa] Length = 795 Score = 70.9 bits (172), Expect = 2e-10 Identities = 32/47 (68%), Positives = 40/47 (85%) Frame = +3 Query: 3 ELDDDGKRMEILYQNCRVRFVGRKGLPEAGDSLITHIKTARSEITVG 143 EL DDGKRME+LY N ++R VGRKGLP AG+SL+T+IK ARS++ VG Sbjct: 748 ELQDDGKRMEMLYNNFQIRLVGRKGLPNAGESLLTYIKEARSKLNVG 794 >ref|XP_002529806.1| Flavin-containing amine oxidase domain-containing protein, putative [Ricinus communis] gi|223530717|gb|EEF32588.1| Flavin-containing amine oxidase domain-containing protein, putative [Ricinus communis] Length = 793 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/46 (58%), Positives = 34/46 (73%) Frame = +3 Query: 3 ELDDDGKRMEILYQNCRVRFVGRKGLPEAGDSLITHIKTARSEITV 140 ELDDDGKR++ LY + +V+ VGRKGL GD LI HIK AR+ + V Sbjct: 748 ELDDDGKRLKTLYLSFQVKLVGRKGLSHVGDDLIAHIKEARARLGV 793