BLASTX nr result
ID: Jatropha_contig00000362
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000362 (105 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_016971917.1| hypothetical protein [Pseudomonas tolaasii] 64 3e-08 >ref|WP_016971917.1| hypothetical protein [Pseudomonas tolaasii] Length = 116 Score = 63.5 bits (153), Expect = 3e-08 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 10 EFTGDLMELPFREFDVILGMDWLSRHQAIVDC 105 EF DL+ELPF EFDVILGMDWLSRHQAIVDC Sbjct: 49 EFLADLIELPFHEFDVILGMDWLSRHQAIVDC 80