BLASTX nr result
ID: Jatropha_contig00000315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000315 (407 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003606042.1| Ribosomal protein S4 [Medicago truncatula] g... 56 4e-06 >ref|XP_003606042.1| Ribosomal protein S4 [Medicago truncatula] gi|358349397|ref|XP_003638724.1| Ribosomal protein S4 [Medicago truncatula] gi|355504659|gb|AES85862.1| Ribosomal protein S4 [Medicago truncatula] gi|355507097|gb|AES88239.1| Ribosomal protein S4 [Medicago truncatula] Length = 234 Score = 56.2 bits (134), Expect = 4e-06 Identities = 30/33 (90%), Positives = 30/33 (90%), Gaps = 1/33 (3%) Frame = +3 Query: 177 M*ARLAQRLEHRICNAMVIGSTPIAG-FSLFVF 272 M ARLAQRLEHRICNAMVIGS PIAG FSLFVF Sbjct: 1 MRARLAQRLEHRICNAMVIGSIPIAGFFSLFVF 33