BLASTX nr result
ID: Jatropha_contig00000272
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000272 (637 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabac... 110 4e-22 ref|XP_006301510.1| hypothetical protein CARUB_v10021936mg, part... 68 2e-09 >ref|YP_173386.1| hypothetical protein NitaMp040 [Nicotiana tabacum] gi|56806549|dbj|BAD83450.1| hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 108 Score = 110 bits (274), Expect = 4e-22 Identities = 55/63 (87%), Positives = 56/63 (88%) Frame = +3 Query: 444 LGEEGISIAKDSDSIQPQVPLRLPCYDFSPVEDPTVVCANKTTKSLCSTSGTQKSWVIIG 623 LGEE ISIAKDS IQPQVPLRLPCYDF+PVEDPTVVCANKTTK LC TS QKSWVIIG Sbjct: 40 LGEECISIAKDS--IQPQVPLRLPCYDFTPVEDPTVVCANKTTKGLCGTSVPQKSWVIIG 97 Query: 624 PML 632 PML Sbjct: 98 PML 100 >ref|XP_006301510.1| hypothetical protein CARUB_v10021936mg, partial [Capsella rubella] gi|482570220|gb|EOA34408.1| hypothetical protein CARUB_v10021936mg, partial [Capsella rubella] Length = 72 Score = 68.2 bits (165), Expect = 2e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +3 Query: 480 DSIQPQVPLRLPCYDFSPVEDPTVVCANKTTKSLCSTS 593 DSIQPQVPL LPCY+F+ VEDP VVCANKT KSLC TS Sbjct: 35 DSIQPQVPLWLPCYEFTRVEDPIVVCANKTIKSLCGTS 72