BLASTX nr result
ID: Jatropha_contig00000213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000213 (276 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW90148.2| oleosin 1 [Jatropha curcas] 74 1e-11 >gb|ABW90148.2| oleosin 1 [Jatropha curcas] Length = 147 Score = 74.3 bits (181), Expect = 1e-11 Identities = 36/36 (100%), Positives = 36/36 (100%) Frame = +2 Query: 2 WTMQMEMAKRRAQETTGQLGQKAREVGQKAQEVAKT 109 WTMQMEMAKRRAQETTGQLGQKAREVGQKAQEVAKT Sbjct: 112 WTMQMEMAKRRAQETTGQLGQKAREVGQKAQEVAKT 147