BLASTX nr result
ID: Jatropha_contig00000162
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Jatropha_contig00000162 (471 letters) Database: NCBI-nr (updated 2014/02/11) 35,149,712 sequences; 12,374,887,350 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis tha... 59 5e-07 >ref|NP_085566.1| hypothetical protein ArthMp044 [Arabidopsis thaliana] gi|45477063|sp|P92544.1|M1130_ARATH RecName: Full=Uncharacterized mitochondrial protein AtMg01130; AltName: Full=ORF106f gi|1785767|emb|CAA69797.1| unnamed protein product [Arabidopsis thaliana] Length = 106 Score = 59.3 bits (142), Expect = 5e-07 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = +2 Query: 374 VTALQILFSLIRYVTETIRSVSVLLTDSEDEP 469 VTALQILFSLIRYVTETIRSVSVL +DSEDEP Sbjct: 3 VTALQILFSLIRYVTETIRSVSVLFSDSEDEP 34