BLASTX nr result
ID: Glycyrrhiza36_contig00039891
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00039891 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013468791.1 P-loop nucleoside triphosphate hydrolase superfam... 54 5e-06 >XP_013468791.1 P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] KEH42828.1 P-loop nucleoside triphosphate hydrolase superfamily protein [Medicago truncatula] Length = 663 Score = 53.9 bits (128), Expect = 5e-06 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -1 Query: 113 VRDGKKIHTRGYPRIKSAMGTGWVP*RVPAGKVNGYL 3 V GKKI TRGYPRIKS MGT V RVPAG +NGYL Sbjct: 242 VGGGKKIRTRGYPRIKSVMGTERVAKRVPAGIINGYL 278