BLASTX nr result
ID: Glycyrrhiza36_contig00039657
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00039657 (491 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007141887.1 hypothetical protein PHAVU_008G234100g [Phaseolus... 54 6e-06 >XP_007141887.1 hypothetical protein PHAVU_008G234100g [Phaseolus vulgaris] ESW13881.1 hypothetical protein PHAVU_008G234100g [Phaseolus vulgaris] Length = 160 Score = 53.5 bits (127), Expect = 6e-06 Identities = 32/55 (58%), Positives = 37/55 (67%), Gaps = 8/55 (14%) Frame = -3 Query: 141 MVSPTHSWNSPQNFAIVLLLFLCITISSPVEATTSSSKLLD--------TEIKCG 1 MVSPT +W SPQ IVLLLF C+TISSP+ A TSS+KL TE+KCG Sbjct: 1 MVSPTKTW-SPQKLTIVLLLF-CVTISSPIYAITSSTKLDQPLASQQPYTEVKCG 53