BLASTX nr result
ID: Glycyrrhiza36_contig00039542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00039542 (210 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN27509.1 Protein notum like [Glycine soja] 54 1e-06 XP_003547731.1 PREDICTED: pectin acetylesterase 8-like [Glycine ... 54 1e-06 XP_004509558.1 PREDICTED: pectin acetylesterase 8 [Cicer arietin... 53 2e-06 XP_007156332.1 hypothetical protein PHAVU_003G277600g [Phaseolus... 53 2e-06 XP_003547821.1 PREDICTED: pectin acetylesterase 8-like [Glycine ... 52 4e-06 XP_014507308.1 PREDICTED: pectin acetylesterase 8-like [Vigna ra... 52 4e-06 XP_003547822.1 PREDICTED: pectin acetylesterase 8-like [Glycine ... 51 8e-06 >KHN27509.1 Protein notum like [Glycine soja] Length = 398 Score = 53.5 bits (127), Expect = 1e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +3 Query: 78 MESARITQWXXXXXXXXXXXKAEGNFVPITQVENAVSKGAVCLD 209 MESARI+QW KAEG+ VP+T VENA SKGAVCLD Sbjct: 1 MESARISQWLNLLVCVLLLLKAEGSSVPLTLVENAESKGAVCLD 44 >XP_003547731.1 PREDICTED: pectin acetylesterase 8-like [Glycine max] XP_014624734.1 PREDICTED: pectin acetylesterase 8-like [Glycine max] XP_014624735.1 PREDICTED: pectin acetylesterase 8-like [Glycine max] KRH07235.1 hypothetical protein GLYMA_16G075800 [Glycine max] KRH07236.1 hypothetical protein GLYMA_16G075800 [Glycine max] KRH07237.1 hypothetical protein GLYMA_16G075800 [Glycine max] Length = 398 Score = 53.5 bits (127), Expect = 1e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = +3 Query: 78 MESARITQWXXXXXXXXXXXKAEGNFVPITQVENAVSKGAVCLD 209 MESARI+QW KAEG+ VP+T VENA SKGAVCLD Sbjct: 1 MESARISQWLNLLVCVLLLLKAEGSSVPLTLVENAESKGAVCLD 44 >XP_004509558.1 PREDICTED: pectin acetylesterase 8 [Cicer arietinum] XP_012573778.1 PREDICTED: pectin acetylesterase 8 [Cicer arietinum] Length = 397 Score = 53.1 bits (126), Expect = 2e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = +3 Query: 78 MESARITQWXXXXXXXXXXXKAEGNFVPITQVENAVSKGAVCLD 209 MESARI QW AEGNFVP+T++ENAVSKGAVCLD Sbjct: 1 MESARIIQWLVLCALLSLH--AEGNFVPMTRLENAVSKGAVCLD 42 >XP_007156332.1 hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris] ESW28326.1 hypothetical protein PHAVU_003G277600g [Phaseolus vulgaris] Length = 399 Score = 53.1 bits (126), Expect = 2e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = +3 Query: 78 MESARITQWXXXXXXXXXXXKAEGNFVPITQVENAVSKGAVCLD 209 MES RI QW KAEG+ VP+T VENA+SKGAVCLD Sbjct: 1 MESVRIIQWLNLVACVLLLLKAEGSLVPLTLVENALSKGAVCLD 44 >XP_003547821.1 PREDICTED: pectin acetylesterase 8-like [Glycine max] XP_014623997.1 PREDICTED: pectin acetylesterase 8-like [Glycine max] KHN26083.1 Protein notum like [Glycine soja] KRH07739.1 hypothetical protein GLYMA_16G107600 [Glycine max] KRH07740.1 hypothetical protein GLYMA_16G107600 [Glycine max] KRH07741.1 hypothetical protein GLYMA_16G107600 [Glycine max] Length = 398 Score = 52.0 bits (123), Expect = 4e-06 Identities = 26/44 (59%), Positives = 29/44 (65%) Frame = +3 Query: 78 MESARITQWXXXXXXXXXXXKAEGNFVPITQVENAVSKGAVCLD 209 MESARI+QW KAEG+ VP+ VENA SKGAVCLD Sbjct: 1 MESARISQWLNLLVCVLLLLKAEGSLVPLILVENAESKGAVCLD 44 >XP_014507308.1 PREDICTED: pectin acetylesterase 8-like [Vigna radiata var. radiata] XP_014507309.1 PREDICTED: pectin acetylesterase 8-like [Vigna radiata var. radiata] Length = 399 Score = 52.0 bits (123), Expect = 4e-06 Identities = 25/44 (56%), Positives = 29/44 (65%) Frame = +3 Query: 78 MESARITQWXXXXXXXXXXXKAEGNFVPITQVENAVSKGAVCLD 209 MES R+ QW KAEG+ VP+T VENA+SKGAVCLD Sbjct: 1 MESGRMIQWLNLVVCVLLLLKAEGSLVPLTLVENALSKGAVCLD 44 >XP_003547822.1 PREDICTED: pectin acetylesterase 8-like [Glycine max] KHN26082.1 Protein notum like [Glycine soja] KRH07738.1 hypothetical protein GLYMA_16G107500 [Glycine max] Length = 398 Score = 51.2 bits (121), Expect = 8e-06 Identities = 25/44 (56%), Positives = 30/44 (68%) Frame = +3 Query: 78 MESARITQWXXXXXXXXXXXKAEGNFVPITQVENAVSKGAVCLD 209 MESARI++W KAEG+ VP+T V+NA SKGAVCLD Sbjct: 1 MESARISKWLNLLVCVLLLLKAEGSLVPLTLVKNAESKGAVCLD 44