BLASTX nr result
ID: Glycyrrhiza36_contig00036307
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00036307 (398 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK49285.1 unknown [Lotus japonicus] 65 6e-11 XP_004501761.1 PREDICTED: random slug protein 5-like [Cicer arie... 67 1e-10 XP_013446941.1 polyphosphoinositide-binding protein [Medicago tr... 66 2e-10 XP_013446942.1 polyphosphoinositide-binding protein [Medicago tr... 66 3e-10 GAU42646.1 hypothetical protein TSUD_398510 [Trifolium subterran... 66 3e-10 XP_004503847.1 PREDICTED: random slug protein 5-like [Cicer arie... 65 4e-10 KDO57636.1 hypothetical protein CISIN_1g043459mg [Citrus sinensis] 65 4e-10 KYP59721.1 Random slug protein 5 [Cajanus cajan] 65 4e-10 XP_015387701.1 PREDICTED: CRAL-TRIO domain-containing protein YK... 65 4e-10 XP_006436972.1 hypothetical protein CICLE_v10032562mg [Citrus cl... 65 4e-10 XP_006485074.1 PREDICTED: CRAL-TRIO domain-containing protein YK... 65 4e-10 XP_013446940.1 polyphosphoinositide-binding protein [Medicago tr... 65 5e-10 GAU25463.1 hypothetical protein TSUD_71170 [Trifolium subterraneum] 64 7e-10 ACJ85443.1 unknown [Medicago truncatula] 65 8e-10 XP_011082916.1 PREDICTED: random slug protein 5-like [Sesamum in... 64 2e-09 KHN09704.1 Random slug protein 5 [Glycine soja] 63 3e-09 NP_001241473.1 uncharacterized protein LOC100797666 [Glycine max... 63 3e-09 KYP48995.1 Random slug protein 5 [Cajanus cajan] 63 3e-09 XP_003602742.1 polyphosphoinositide-binding protein [Medicago tr... 63 3e-09 AFK46517.1 unknown [Medicago truncatula] 63 3e-09 >AFK49285.1 unknown [Lotus japonicus] Length = 110 Score = 64.7 bits (156), Expect = 6e-11 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFV++ KL+STLLEEIDES LPEIYGGQL LVPIQ S Sbjct: 72 KIVFVDNKKLKSTLLEEIDESQLPEIYGGQLPLVPIQDS 110 >XP_004501761.1 PREDICTED: random slug protein 5-like [Cicer arietinum] Length = 268 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/39 (79%), Positives = 37/39 (94%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFV++ KL+STLLEEIDES +PEIYGGQLQLVP+Q+S Sbjct: 230 KIVFVDNKKLKSTLLEEIDESQIPEIYGGQLQLVPVQNS 268 >XP_013446941.1 polyphosphoinositide-binding protein [Medicago truncatula] KEH20968.1 polyphosphoinositide-binding protein [Medicago truncatula] Length = 253 Score = 65.9 bits (159), Expect = 2e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE++KL+STLLE+IDES LPEIYGG+LQLVPIQ S Sbjct: 214 KIVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQDS 252 >XP_013446942.1 polyphosphoinositide-binding protein [Medicago truncatula] KEH20969.1 polyphosphoinositide-binding protein [Medicago truncatula] Length = 263 Score = 65.9 bits (159), Expect = 3e-10 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE++KL+STLLE+IDES LPEIYGG+LQLVPIQ S Sbjct: 224 KIVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQDS 262 >GAU42646.1 hypothetical protein TSUD_398510 [Trifolium subterraneum] Length = 268 Score = 65.9 bits (159), Expect = 3e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE+ KL+STLLEEIDES LPEIYGGQL LVPIQ S Sbjct: 230 KIVFVENKKLKSTLLEEIDESQLPEIYGGQLALVPIQDS 268 >XP_004503847.1 PREDICTED: random slug protein 5-like [Cicer arietinum] Length = 274 Score = 65.5 bits (158), Expect = 4e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE +KL+STL EEIDES LPEIYGGQLQL+PIQ S Sbjct: 236 KIVFVESNKLKSTLQEEIDESQLPEIYGGQLQLIPIQDS 274 >KDO57636.1 hypothetical protein CISIN_1g043459mg [Citrus sinensis] Length = 243 Score = 65.1 bits (157), Expect = 4e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFV+D KL+STLLEEIDES +PEIYGGQL LVPIQ + Sbjct: 205 KIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPIQET 243 >KYP59721.1 Random slug protein 5 [Cajanus cajan] Length = 246 Score = 65.1 bits (157), Expect = 4e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE+ KL+STLLEEIDES LPEIYGGQ+ LVPIQ S Sbjct: 208 KIVFVENKKLKSTLLEEIDESQLPEIYGGQMPLVPIQDS 246 >XP_015387701.1 PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X2 [Citrus sinensis] Length = 246 Score = 65.1 bits (157), Expect = 4e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFV+D KL+STLLEEIDES +PEIYGGQL LVPIQ + Sbjct: 208 KIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPIQET 246 >XP_006436972.1 hypothetical protein CICLE_v10032562mg [Citrus clementina] ESR50212.1 hypothetical protein CICLE_v10032562mg [Citrus clementina] Length = 246 Score = 65.1 bits (157), Expect = 4e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFV+D KL+STLLEEIDES +PEIYGGQL LVPIQ + Sbjct: 208 KIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPIQET 246 >XP_006485074.1 PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X1 [Citrus sinensis] XP_015387700.1 PREDICTED: CRAL-TRIO domain-containing protein YKL091C-like isoform X1 [Citrus sinensis] Length = 247 Score = 65.1 bits (157), Expect = 4e-10 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFV+D KL+STLLEEIDES +PEIYGGQL LVPIQ + Sbjct: 209 KIVFVQDKKLKSTLLEEIDESQIPEIYGGQLPLVPIQET 247 >XP_013446940.1 polyphosphoinositide-binding protein [Medicago truncatula] KEH20967.1 polyphosphoinositide-binding protein [Medicago truncatula] Length = 255 Score = 65.1 bits (157), Expect = 5e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQH 285 KIVFVE++KL+STLLE+IDES LPEIYGG+LQLVPIQ+ Sbjct: 217 KIVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPIQN 254 >GAU25463.1 hypothetical protein TSUD_71170 [Trifolium subterraneum] Length = 204 Score = 63.9 bits (154), Expect = 7e-10 Identities = 29/39 (74%), Positives = 37/39 (94%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KI+FVE++K++STLLE+IDES LPEIYGG+LQLVP+Q S Sbjct: 166 KIIFVENNKVKSTLLEDIDESQLPEIYGGKLQLVPVQDS 204 >ACJ85443.1 unknown [Medicago truncatula] Length = 272 Score = 64.7 bits (156), Expect = 8e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE+ KLE+TLLEEIDES LPEIYGG+L LVPIQ S Sbjct: 234 KIVFVENKKLEATLLEEIDESQLPEIYGGKLPLVPIQDS 272 >XP_011082916.1 PREDICTED: random slug protein 5-like [Sesamum indicum] Length = 274 Score = 63.5 bits (153), Expect = 2e-09 Identities = 29/37 (78%), Positives = 35/37 (94%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQ 288 KI+FVE+ KL++TLLEEIDES LPEIYGG++QLVPIQ Sbjct: 236 KIIFVENKKLQATLLEEIDESQLPEIYGGKMQLVPIQ 272 >KHN09704.1 Random slug protein 5 [Glycine soja] Length = 265 Score = 63.2 bits (152), Expect = 3e-09 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE+ KL+STLLEEI+ES LP+IYGGQ+ LVPIQ+S Sbjct: 227 KIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQNS 265 >NP_001241473.1 uncharacterized protein LOC100797666 [Glycine max] ACU22859.1 unknown [Glycine max] ACU23015.1 unknown [Glycine max] KRH54081.1 hypothetical protein GLYMA_06G163500 [Glycine max] Length = 265 Score = 63.2 bits (152), Expect = 3e-09 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE+ KL+STLLEEI+ES LP+IYGGQ+ LVPIQ+S Sbjct: 227 KIVFVENKKLKSTLLEEIEESQLPDIYGGQMPLVPIQNS 265 >KYP48995.1 Random slug protein 5 [Cajanus cajan] Length = 234 Score = 62.8 bits (151), Expect = 3e-09 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE +K++STLLEEID S LPEIYGGQL LVPIQ S Sbjct: 196 KIVFVEKNKVKSTLLEEIDHSQLPEIYGGQLSLVPIQDS 234 >XP_003602742.1 polyphosphoinositide-binding protein [Medicago truncatula] AES72993.1 polyphosphoinositide-binding protein [Medicago truncatula] AFK48922.1 unknown [Medicago truncatula] Length = 272 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE+ KL++TLLEEIDES LPEIYGG+L LVPIQ S Sbjct: 234 KIVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQDS 272 >AFK46517.1 unknown [Medicago truncatula] Length = 272 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/39 (79%), Positives = 35/39 (89%) Frame = -1 Query: 398 KIVFVEDSKLESTLLEEIDESHLPEIYGGQLQLVPIQHS 282 KIVFVE+ KL++TLLEEIDES LPEIYGG+L LVPIQ S Sbjct: 234 KIVFVENKKLKATLLEEIDESQLPEIYGGKLPLVPIQDS 272