BLASTX nr result
ID: Glycyrrhiza36_contig00036172
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00036172 (200 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007134270.1 hypothetical protein PHAVU_010G033000g [Phaseolus... 52 4e-06 >XP_007134270.1 hypothetical protein PHAVU_010G033000g [Phaseolus vulgaris] ESW06264.1 hypothetical protein PHAVU_010G033000g [Phaseolus vulgaris] Length = 680 Score = 52.0 bits (123), Expect = 4e-06 Identities = 27/57 (47%), Positives = 40/57 (70%) Frame = +1 Query: 13 KLLQELLEMLPDETQQREALRKENVEGNTLLHEAVINLKKDYLETVDVIMKLGKKIL 183 +LL ELLEM+PDE ++ AL ++NVEGNT+LHE V + K + VDV+ + ++L Sbjct: 72 QLLSELLEMVPDEEERWNALCRKNVEGNTVLHEIVFSKKAK--KMVDVVFRFEDQLL 126