BLASTX nr result
ID: Glycyrrhiza36_contig00035781
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035781 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFK43594.1 unknown [Medicago truncatula] 82 3e-17 KOM28439.1 hypothetical protein LR48_Vigan543s002700 [Vigna angu... 82 4e-17 XP_014624633.1 PREDICTED: WD repeat-containing protein 74-like [... 83 2e-16 KHN46717.1 WD repeat-containing protein 74 [Glycine soja] 83 2e-16 XP_006583281.2 PREDICTED: WD repeat-containing protein 74 isofor... 82 3e-16 XP_006583280.1 PREDICTED: WD repeat-containing protein 74 isofor... 82 3e-16 XP_007153228.1 hypothetical protein PHAVU_003G017500g [Phaseolus... 82 3e-16 XP_017408884.1 PREDICTED: WD repeat-containing protein 74 isofor... 82 4e-16 XP_014515723.1 PREDICTED: WD repeat-containing protein 74 isofor... 82 4e-16 XP_014633290.1 PREDICTED: WD repeat-containing protein 74 isofor... 82 4e-16 XP_014515722.1 PREDICTED: WD repeat-containing protein 74 isofor... 82 6e-16 XP_014515721.1 PREDICTED: WD repeat-containing protein 74 isofor... 82 6e-16 XP_017408882.1 PREDICTED: WD repeat-containing protein 74 isofor... 82 6e-16 XP_013450245.1 transducin/WD-like repeat-protein [Medicago trunc... 82 6e-16 XP_012568220.1 PREDICTED: LOW QUALITY PROTEIN: WD repeat-contain... 82 7e-16 XP_016183170.1 PREDICTED: WD repeat-containing protein 74 [Arach... 81 8e-16 XP_015956173.1 PREDICTED: LOW QUALITY PROTEIN: WD repeat-contain... 81 8e-16 XP_015882354.1 PREDICTED: WD repeat-containing protein 74 [Zizip... 77 4e-14 XP_011044190.1 PREDICTED: WD repeat-containing protein 74-like i... 76 7e-14 XP_011044189.1 PREDICTED: WD repeat-containing protein 74-like i... 76 7e-14 >AFK43594.1 unknown [Medicago truncatula] Length = 180 Score = 81.6 bits (200), Expect = 3e-17 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPVVASCGL YL+ WDTKTRQ LS+VFL+QHILHVLF Sbjct: 23 IRSIVRHPELPVVASCGLDGYLRLWDTKTRQLLSSVFLKQHILHVLF 69 >KOM28439.1 hypothetical protein LR48_Vigan543s002700 [Vigna angularis] Length = 183 Score = 81.6 bits (200), Expect = 4e-17 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 +KSIVRHP+LP++ASCGL YL+ WDTKTRQ LSAVFL+QH++HVLF Sbjct: 42 IKSIVRHPELPIIASCGLDCYLRLWDTKTRQLLSAVFLKQHVMHVLF 88 >XP_014624633.1 PREDICTED: WD repeat-containing protein 74-like [Glycine max] KRH06614.1 hypothetical protein GLYMA_16G034400 [Glycine max] KRH06615.1 hypothetical protein GLYMA_16G034400 [Glycine max] Length = 446 Score = 83.2 bits (204), Expect = 2e-16 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPV+ASCGL SYL+ WDTKTRQ LSAVFL+QHI+HVLF Sbjct: 305 IRSIVRHPELPVIASCGLDSYLRLWDTKTRQLLSAVFLKQHIMHVLF 351 >KHN46717.1 WD repeat-containing protein 74 [Glycine soja] Length = 466 Score = 83.2 bits (204), Expect = 2e-16 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPV+ASCGL SYL+ WDTKTRQ LSAVFL+QHI+HVLF Sbjct: 325 IRSIVRHPELPVIASCGLDSYLRLWDTKTRQLLSAVFLKQHIMHVLF 371 >XP_006583281.2 PREDICTED: WD repeat-containing protein 74 isoform X3 [Glycine max] Length = 356 Score = 82.0 bits (201), Expect = 3e-16 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIV+HP+LPV+ASCGL SYL+ WDTKTRQ LSAVFL+QHI+HVLF Sbjct: 302 IRSIVKHPELPVIASCGLDSYLRLWDTKTRQLLSAVFLKQHIIHVLF 348 >XP_006583280.1 PREDICTED: WD repeat-containing protein 74 isoform X2 [Glycine max] KRH48097.1 hypothetical protein GLYMA_07G068400 [Glycine max] KRH48098.1 hypothetical protein GLYMA_07G068400 [Glycine max] Length = 357 Score = 82.0 bits (201), Expect = 3e-16 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIV+HP+LPV+ASCGL SYL+ WDTKTRQ LSAVFL+QHI+HVLF Sbjct: 302 IRSIVKHPELPVIASCGLDSYLRLWDTKTRQLLSAVFLKQHIIHVLF 348 >XP_007153228.1 hypothetical protein PHAVU_003G017500g [Phaseolus vulgaris] XP_007153229.1 hypothetical protein PHAVU_003G017500g [Phaseolus vulgaris] ESW25222.1 hypothetical protein PHAVU_003G017500g [Phaseolus vulgaris] ESW25223.1 hypothetical protein PHAVU_003G017500g [Phaseolus vulgaris] Length = 442 Score = 82.4 bits (202), Expect = 3e-16 Identities = 35/47 (74%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LP++ASCGL SYL+ WDTKTRQ LSA+FL+QHI+HVLF Sbjct: 305 IRSIVRHPELPIIASCGLDSYLRLWDTKTRQLLSAIFLKQHIMHVLF 351 >XP_017408884.1 PREDICTED: WD repeat-containing protein 74 isoform X2 [Vigna angularis] Length = 359 Score = 81.6 bits (200), Expect = 4e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 +KSIVRHP+LP++ASCGL YL+ WDTKTRQ LSAVFL+QH++HVLF Sbjct: 305 IKSIVRHPELPIIASCGLDCYLRLWDTKTRQLLSAVFLKQHVMHVLF 351 >XP_014515723.1 PREDICTED: WD repeat-containing protein 74 isoform X3 [Vigna radiata var. radiata] Length = 359 Score = 81.6 bits (200), Expect = 4e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 +KSIVRHP+LP++ASCGL YL+ WDTKTRQ LSAVFL+QH++HVLF Sbjct: 305 IKSIVRHPELPIIASCGLDCYLRLWDTKTRQLLSAVFLKQHVMHVLF 351 >XP_014633290.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Glycine max] XP_014633292.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Glycine max] XP_014633293.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Glycine max] XP_014633294.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Glycine max] XP_014633295.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Glycine max] KHN26947.1 WD repeat-containing protein 74 [Glycine soja] KRH48095.1 hypothetical protein GLYMA_07G068400 [Glycine max] KRH48096.1 hypothetical protein GLYMA_07G068400 [Glycine max] Length = 445 Score = 82.0 bits (201), Expect = 4e-16 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIV+HP+LPV+ASCGL SYL+ WDTKTRQ LSAVFL+QHI+HVLF Sbjct: 302 IRSIVKHPELPVIASCGLDSYLRLWDTKTRQLLSAVFLKQHIIHVLF 348 >XP_014515722.1 PREDICTED: WD repeat-containing protein 74 isoform X2 [Vigna radiata var. radiata] Length = 436 Score = 81.6 bits (200), Expect = 6e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 +KSIVRHP+LP++ASCGL YL+ WDTKTRQ LSAVFL+QH++HVLF Sbjct: 305 IKSIVRHPELPIIASCGLDCYLRLWDTKTRQLLSAVFLKQHVMHVLF 351 >XP_014515721.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Vigna radiata var. radiata] XP_014515724.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Vigna radiata var. radiata] XP_014515725.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Vigna radiata var. radiata] Length = 440 Score = 81.6 bits (200), Expect = 6e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 +KSIVRHP+LP++ASCGL YL+ WDTKTRQ LSAVFL+QH++HVLF Sbjct: 305 IKSIVRHPELPIIASCGLDCYLRLWDTKTRQLLSAVFLKQHVMHVLF 351 >XP_017408882.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Vigna angularis] XP_017408883.1 PREDICTED: WD repeat-containing protein 74 isoform X1 [Vigna angularis] BAT97969.1 hypothetical protein VIGAN_09156600 [Vigna angularis var. angularis] Length = 446 Score = 81.6 bits (200), Expect = 6e-16 Identities = 35/47 (74%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 +KSIVRHP+LP++ASCGL YL+ WDTKTRQ LSAVFL+QH++HVLF Sbjct: 305 IKSIVRHPELPIIASCGLDCYLRLWDTKTRQLLSAVFLKQHVMHVLF 351 >XP_013450245.1 transducin/WD-like repeat-protein [Medicago truncatula] KEH24273.1 transducin/WD-like repeat-protein [Medicago truncatula] Length = 453 Score = 81.6 bits (200), Expect = 6e-16 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPVVASCGL YL+ WDTKTRQ LS+VFL+QHILHVLF Sbjct: 304 IRSIVRHPELPVVASCGLDGYLRLWDTKTRQLLSSVFLKQHILHVLF 350 >XP_012568220.1 PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein DDB_G0290555-like [Cicer arietinum] Length = 583 Score = 81.6 bits (200), Expect = 7e-16 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPVVASCGL YL+ WDTKTRQ LS+VFL+QHILHVLF Sbjct: 304 IRSIVRHPELPVVASCGLDGYLRLWDTKTRQLLSSVFLKQHILHVLF 350 >XP_016183170.1 PREDICTED: WD repeat-containing protein 74 [Arachis ipaensis] Length = 425 Score = 81.3 bits (199), Expect = 8e-16 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPVVASCGL SYL+ WDTKTRQ LS+VFL+QH+LHV+F Sbjct: 301 IRSIVRHPELPVVASCGLDSYLRIWDTKTRQLLSSVFLKQHLLHVVF 347 >XP_015956173.1 PREDICTED: LOW QUALITY PROTEIN: WD repeat-containing protein 74 [Arachis duranensis] Length = 454 Score = 81.3 bits (199), Expect = 8e-16 Identities = 36/47 (76%), Positives = 44/47 (93%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPVVASCGL SYL+ WDTKTRQ LS+VFL+QH+LHV+F Sbjct: 301 IRSIVRHPELPVVASCGLDSYLRLWDTKTRQLLSSVFLKQHLLHVVF 347 >XP_015882354.1 PREDICTED: WD repeat-containing protein 74 [Ziziphus jujuba] Length = 438 Score = 76.6 bits (187), Expect = 4e-14 Identities = 34/47 (72%), Positives = 42/47 (89%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SIVRHP+LPV+ASCGL SYL+ WD KTRQ LSAVFL+QH++ VLF Sbjct: 305 IRSIVRHPELPVLASCGLDSYLRFWDVKTRQLLSAVFLKQHLVKVLF 351 >XP_011044190.1 PREDICTED: WD repeat-containing protein 74-like isoform X2 [Populus euphratica] Length = 424 Score = 75.9 bits (185), Expect = 7e-14 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SI RHP+LPV+ASCGL SYL+ WDTKTRQ LSAVFL+QH+ +V+F Sbjct: 301 IRSIARHPELPVIASCGLDSYLRLWDTKTRQLLSAVFLKQHLTNVVF 347 >XP_011044189.1 PREDICTED: WD repeat-containing protein 74-like isoform X1 [Populus euphratica] Length = 425 Score = 75.9 bits (185), Expect = 7e-14 Identities = 33/47 (70%), Positives = 42/47 (89%) Frame = -2 Query: 143 LKSIVRHPKLPVVASCGLGSYLQHWDTKTRQFLSAVFLEQHILHVLF 3 ++SI RHP+LPV+ASCGL SYL+ WDTKTRQ LSAVFL+QH+ +V+F Sbjct: 302 IRSIARHPELPVIASCGLDSYLRLWDTKTRQLLSAVFLKQHLTNVVF 348