BLASTX nr result
ID: Glycyrrhiza36_contig00035748
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035748 (339 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35738.1 hypothetical protein TSUD_370030 [Trifolium subterran... 74 4e-13 GAU49965.1 hypothetical protein TSUD_290850 [Trifolium subterran... 72 1e-12 XP_003619304.2 pentatricopeptide (PPR) repeat protein [Medicago ... 72 3e-12 XP_013441668.1 pentatricopeptide (PPR) repeat protein [Medicago ... 69 2e-11 XP_003594869.1 pentatricopeptide (PPR) repeat protein [Medicago ... 69 2e-11 KRH39072.1 hypothetical protein GLYMA_09G176400 [Glycine max] 69 2e-11 KRH39058.1 hypothetical protein GLYMA_09G175200 [Glycine max] 69 2e-11 KRH39004.1 hypothetical protein GLYMA_09G171200 [Glycine max] 69 2e-11 XP_006587464.2 PREDICTED: putative pentatricopeptide repeat-cont... 69 2e-11 XP_014617713.1 PREDICTED: putative pentatricopeptide repeat-cont... 69 2e-11 XP_003533312.1 PREDICTED: putative pentatricopeptide repeat-cont... 69 2e-11 XP_004504486.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 2e-11 XP_014617709.1 PREDICTED: putative pentatricopeptide repeat-cont... 69 2e-11 AFK39839.1 unknown [Medicago truncatula] 64 3e-11 GAU35736.1 hypothetical protein TSUD_370010 [Trifolium subterran... 69 3e-11 XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 3e-11 XP_004514199.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 5e-11 XP_013452082.1 pentatricopeptide (PPR) repeat protein [Medicago ... 68 6e-11 KYP46190.1 hypothetical protein KK1_032235 [Cajanus cajan] 68 6e-11 XP_013443425.1 pentatricopeptide (PPR) repeat protein [Medicago ... 68 6e-11 >GAU35738.1 hypothetical protein TSUD_370030 [Trifolium subterraneum] Length = 426 Score = 73.9 bits (180), Expect = 4e-13 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA+TY+TIIYALFE DEN KA+KL+REMI RGLL Sbjct: 386 EDNGCIPNAITYQTIIYALFENDENDKAEKLLREMIARGLL 426 >GAU49965.1 hypothetical protein TSUD_290850 [Trifolium subterraneum] Length = 502 Score = 72.4 bits (176), Expect = 1e-12 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL*E 209 EDNGCIPNALTY TIIYALFE DEN KA+KL+ EMI RGLL E Sbjct: 458 EDNGCIPNALTYRTIIYALFENDENDKAEKLLHEMIARGLLFE 500 >XP_003619304.2 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES75522.2 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 567 Score = 71.6 bits (174), Expect = 3e-12 Identities = 33/41 (80%), Positives = 39/41 (95%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIP+ +TY+TII+ALFEKDEN KA+KLVRE+IVRGLL Sbjct: 527 EDNGCIPDVVTYQTIIHALFEKDENDKAEKLVRELIVRGLL 567 >XP_013441668.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH15693.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 320 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA+TY TII+ALF+ DEN KA+KL+REMI RGLL Sbjct: 280 EDNGCIPNAVTYATIIHALFKNDENDKAEKLLREMIARGLL 320 >XP_003594869.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES65120.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 545 Score = 69.3 bits (168), Expect = 2e-11 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 +DNGCIPNA+TYE +I++LFEKDEN KA+KL+REMI RGLL Sbjct: 505 KDNGCIPNAITYEILIHSLFEKDENDKAEKLLREMIARGLL 545 >KRH39072.1 hypothetical protein GLYMA_09G176400 [Glycine max] Length = 496 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII ALF+KDEN KA+KL+R+MI RGLL Sbjct: 456 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 496 >KRH39058.1 hypothetical protein GLYMA_09G175200 [Glycine max] Length = 497 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII ALF+KDEN KA+KL+R+MI RGLL Sbjct: 457 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 497 >KRH39004.1 hypothetical protein GLYMA_09G171200 [Glycine max] Length = 497 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII ALF+KDEN KA+KL+R+MI RGLL Sbjct: 457 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 497 >XP_006587464.2 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] Length = 545 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII ALF+KDEN KA+KL+R+MI RGLL Sbjct: 505 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 545 >XP_014617713.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] Length = 546 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII ALF+KDEN KA+KL+R+MI RGLL Sbjct: 506 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 546 >XP_003533312.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] Length = 546 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII ALF+KDEN KA+KL+R+MI RGLL Sbjct: 506 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 546 >XP_004504486.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cicer arietinum] XP_004504487.1 PREDICTED: pentatricopeptide repeat-containing protein At3g22470, mitochondrial-like [Cicer arietinum] Length = 550 Score = 68.9 bits (167), Expect = 2e-11 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 +DNGCIPNALTYE +I++LFEKDEN KA+ L++EMIVRGLL Sbjct: 510 KDNGCIPNALTYEIVIHSLFEKDENEKAENLLQEMIVRGLL 550 >XP_014617709.1 PREDICTED: putative pentatricopeptide repeat-containing protein At1g12700, mitochondrial [Glycine max] Length = 555 Score = 68.9 bits (167), Expect = 2e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA T+ETII ALF+KDEN KA+KL+R+MI RGLL Sbjct: 515 EDNGCIPNAFTFETIIIALFKKDENDKAEKLLRQMIARGLL 555 >AFK39839.1 unknown [Medicago truncatula] Length = 62 Score = 63.5 bits (153), Expect = 3e-11 Identities = 29/41 (70%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 E+NGCIP+A+TYE II +LF+KD+N KA+KL+REMI RGLL Sbjct: 22 EENGCIPDAVTYEIIICSLFDKDKNDKAEKLLREMITRGLL 62 >GAU35736.1 hypothetical protein TSUD_370010 [Trifolium subterraneum] Length = 459 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVR 224 EDNGCIPNALTY TIIYALFE DEN KA+KL+REMI R Sbjct: 371 EDNGCIPNALTYRTIIYALFENDENDKAEKLLREMIAR 408 >XP_003549125.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] XP_014624499.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62930, chloroplastic-like [Glycine max] KHN31545.1 Pentatricopeptide repeat-containing protein, chloroplastic [Glycine soja] KRH09154.1 hypothetical protein GLYMA_16G199700 [Glycine max] Length = 556 Score = 68.6 bits (166), Expect = 3e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA+T++ II ALFEKDEN KA+KL+REMI RGLL Sbjct: 516 EDNGCIPNAITFDIIICALFEKDENDKAEKLLREMIARGLL 556 >XP_004514199.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] XP_012575233.1 PREDICTED: pentatricopeptide repeat-containing protein At1g62670, mitochondrial-like [Cicer arietinum] Length = 252 Score = 67.0 bits (162), Expect = 5e-11 Identities = 31/41 (75%), Positives = 38/41 (92%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 +DNGCIP+ALTYE +I++LFEK EN KA+KL+REMIVRGLL Sbjct: 212 KDNGCIPDALTYEIVIHSLFEKYENEKAEKLLREMIVRGLL 252 >XP_013452082.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH26110.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 456 Score = 67.8 bits (164), Expect = 6e-11 Identities = 32/41 (78%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIP+A+TYETII ALF+ DEN KA+KL+REMI RGLL Sbjct: 416 EDNGCIPDAVTYETIIRALFKNDENDKAEKLLREMIARGLL 456 >KYP46190.1 hypothetical protein KK1_032235 [Cajanus cajan] Length = 487 Score = 67.8 bits (164), Expect = 6e-11 Identities = 31/41 (75%), Positives = 37/41 (90%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGCIPNA+T+E II ALF+KDEN KA+KL+REMI RG+L Sbjct: 447 EDNGCIPNAITFEIIIRALFQKDENDKAEKLLREMIARGIL 487 >XP_013443425.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] KEH17450.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 496 Score = 67.8 bits (164), Expect = 6e-11 Identities = 31/41 (75%), Positives = 36/41 (87%) Frame = -3 Query: 337 EDNGCIPNALTYETIIYALFEKDENYKAKKLVREMIVRGLL 215 EDNGC P+ +TYETIIYALF+ DEN KA+KL+REMI RGLL Sbjct: 456 EDNGCTPDVVTYETIIYALFKNDENDKAEKLLREMITRGLL 496