BLASTX nr result
ID: Glycyrrhiza36_contig00035638
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035638 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP60766.1 Pentatricopeptide repeat-containing protein At1g25360... 79 1e-15 XP_014512605.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 5e-15 XP_017434376.1 PREDICTED: pentatricopeptide repeat-containing pr... 78 5e-15 XP_007144135.1 hypothetical protein PHAVU_007G131600g [Phaseolus... 78 5e-15 XP_003590744.1 pentatricopeptide (PPR) repeat protein [Medicago ... 77 1e-14 XP_004495263.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 1e-14 XP_016176506.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 3e-14 XP_019441088.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 5e-14 CBI19832.3 unnamed protein product, partial [Vitis vinifera] 74 8e-14 XP_003535453.2 PREDICTED: pentatricopeptide repeat-containing pr... 74 9e-14 XP_002280360.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 9e-14 KRG92255.1 hypothetical protein GLYMA_20G200100 [Glycine max] 74 1e-13 XP_015940905.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-13 XP_010271478.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-13 KVF06906.1 Pentatricopeptide repeat-containing protein, partial ... 72 4e-13 XP_015884794.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 6e-13 XP_010093155.1 hypothetical protein L484_005164 [Morus notabilis... 72 6e-13 XP_018821025.1 PREDICTED: pentatricopeptide repeat-containing pr... 72 8e-13 XP_004301492.2 PREDICTED: pentatricopeptide repeat-containing pr... 71 1e-12 XP_002893429.1 pentatricopeptide repeat-containing protein [Arab... 70 2e-12 >KYP60766.1 Pentatricopeptide repeat-containing protein At1g25360 family [Cajanus cajan] Length = 722 Score = 79.3 bits (194), Expect = 1e-15 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFISK+VEREIVVRDRKRFHHFRNGECSCGNYW Sbjct: 688 AFKFISKVVEREIVVRDRKRFHHFRNGECSCGNYW 722 >XP_014512605.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vigna radiata var. radiata] Length = 787 Score = 77.8 bits (190), Expect = 5e-15 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 753 AFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_017434376.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vigna angularis] KOM52437.1 hypothetical protein LR48_Vigan09g109600 [Vigna angularis] BAT94687.1 hypothetical protein VIGAN_08130900 [Vigna angularis var. angularis] Length = 787 Score = 77.8 bits (190), Expect = 5e-15 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 753 AFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_007144135.1 hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] ESW16129.1 hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] Length = 787 Score = 77.8 bits (190), Expect = 5e-15 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFISK+V+REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 753 AFKFISKVVDREIIVRDRKRFHHFRNGECSCGNYW 787 >XP_003590744.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES60995.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 795 Score = 77.0 bits (188), Expect = 1e-14 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFK+ISK+VEREIVVRDRKRFHHF+NGECSCGNYW Sbjct: 761 AFKYISKVVEREIVVRDRKRFHHFKNGECSCGNYW 795 >XP_004495263.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] XP_012569722.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Cicer arietinum] Length = 795 Score = 77.0 bits (188), Expect = 1e-14 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFISK+V REIVVRDRKRFHHFRNGECSCGNYW Sbjct: 761 AFKFISKVVAREIVVRDRKRFHHFRNGECSCGNYW 795 >XP_016176506.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Arachis ipaensis] Length = 789 Score = 75.5 bits (184), Expect = 3e-14 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFIS++V+REIVVRDRKRFHHF+NGECSCGNYW Sbjct: 755 AFKFISRVVKREIVVRDRKRFHHFKNGECSCGNYW 789 >XP_019441088.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Lupinus angustifolius] Length = 787 Score = 75.1 bits (183), Expect = 5e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFIS++V REI+VRDRKRFHHFRNGECSCGNYW Sbjct: 753 AFKFISRVVGREIIVRDRKRFHHFRNGECSCGNYW 787 >CBI19832.3 unnamed protein product, partial [Vitis vinifera] Length = 544 Score = 74.3 bits (181), Expect = 8e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKF+SK+VEREIVVRD KRFHHF+NGECSCGNYW Sbjct: 510 AFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 544 >XP_003535453.2 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Glycine max] KRH34548.1 hypothetical protein GLYMA_10G190600 [Glycine max] Length = 787 Score = 74.3 bits (181), Expect = 9e-14 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFK+ISK+V+REI+VRDRKRFHHFRNGECSC NYW Sbjct: 753 AFKYISKVVDREIIVRDRKRFHHFRNGECSCSNYW 787 >XP_002280360.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 74.3 bits (181), Expect = 9e-14 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKF+SK+VEREIVVRD KRFHHF+NGECSCGNYW Sbjct: 765 AFKFMSKVVEREIVVRDGKRFHHFKNGECSCGNYW 799 >KRG92255.1 hypothetical protein GLYMA_20G200100 [Glycine max] Length = 686 Score = 73.9 bits (180), Expect = 1e-13 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFK+ISKLV++EI+VRDRKRFHHFRNGECSC NYW Sbjct: 652 AFKYISKLVDQEIIVRDRKRFHHFRNGECSCSNYW 686 >XP_015940905.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Arachis duranensis] Length = 789 Score = 73.6 bits (179), Expect = 2e-13 Identities = 30/35 (85%), Positives = 35/35 (100%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKFIS++V+REIVVRDRKRFHHF+NGECSCG+YW Sbjct: 755 AFKFISRVVKREIVVRDRKRFHHFKNGECSCGDYW 789 >XP_010271478.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Nelumbo nucifera] Length = 801 Score = 73.6 bits (179), Expect = 2e-13 Identities = 31/35 (88%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKF+SK+VEREIVVRD KRFHHFR+GECSCGNYW Sbjct: 767 AFKFMSKVVEREIVVRDGKRFHHFRDGECSCGNYW 801 >KVF06906.1 Pentatricopeptide repeat-containing protein, partial [Cynara cardunculus var. scolymus] Length = 817 Score = 72.4 bits (176), Expect = 4e-13 Identities = 30/35 (85%), Positives = 34/35 (97%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKF+S++VEREIVVRD KRFHHFRNG+CSCGNYW Sbjct: 783 AFKFMSQVVEREIVVRDGKRFHHFRNGKCSCGNYW 817 >XP_015884794.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Ziziphus jujuba] Length = 800 Score = 72.0 bits (175), Expect = 6e-13 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFKF+SK+VEREI+VRD KRFHHFR GECSCGNYW Sbjct: 766 AFKFMSKVVEREIIVRDGKRFHHFRYGECSCGNYW 800 >XP_010093155.1 hypothetical protein L484_005164 [Morus notabilis] EXB53614.1 hypothetical protein L484_005164 [Morus notabilis] Length = 800 Score = 72.0 bits (175), Expect = 6e-13 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AF F+S++VEREIVVRD KRFHHFRNGECSCGNYW Sbjct: 766 AFMFMSRVVEREIVVRDGKRFHHFRNGECSCGNYW 800 >XP_018821025.1 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Juglans regia] Length = 797 Score = 71.6 bits (174), Expect = 8e-13 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFK++SK+V REIVVRD KRFHHFRNGECSCGNYW Sbjct: 763 AFKYMSKVVGREIVVRDGKRFHHFRNGECSCGNYW 797 >XP_004301492.2 PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Fragaria vesca subsp. vesca] Length = 754 Score = 70.9 bits (172), Expect = 1e-12 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = +3 Query: 3 AFKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 AFK++S++V REIVVRD KRFHHFRNGECSCGNYW Sbjct: 720 AFKYMSRVVGREIVVRDAKRFHHFRNGECSCGNYW 754 >XP_002893429.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] EFH69688.1 pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 790 Score = 70.5 bits (171), Expect = 2e-12 Identities = 26/34 (76%), Positives = 34/34 (100%) Frame = +3 Query: 6 FKFISKLVEREIVVRDRKRFHHFRNGECSCGNYW 107 F+F+SK+V+R+I++RDRKRFHHFRNGECSCGN+W Sbjct: 757 FRFLSKVVQRDIILRDRKRFHHFRNGECSCGNFW 790