BLASTX nr result
ID: Glycyrrhiza36_contig00035417
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035417 (288 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP46436.1 Ethylene-responsive transcription factor ERF012 famil... 54 7e-07 XP_003614739.2 AP2 domain class transcription factor [Medicago t... 54 2e-06 KYP55175.1 Ethylene-responsive transcription factor ERF012 famil... 52 9e-06 >KYP46436.1 Ethylene-responsive transcription factor ERF012 family [Cajanus cajan] Length = 185 Score = 54.3 bits (129), Expect = 7e-07 Identities = 28/44 (63%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -3 Query: 124 DQIDDDASLVSSFEAYQAND---ESMAMMDQWYSLESDLQYSPK 2 DQIDD+ASL+SSFEAY ++D ESMA+M+ WY+ DLQ SPK Sbjct: 109 DQIDDEASLISSFEAYTSSDQANESMAVMEPWYTFADDLQ-SPK 151 >XP_003614739.2 AP2 domain class transcription factor [Medicago truncatula] AES97697.2 AP2 domain class transcription factor [Medicago truncatula] Length = 298 Score = 54.3 bits (129), Expect = 2e-06 Identities = 30/45 (66%), Positives = 32/45 (71%), Gaps = 4/45 (8%) Frame = -3 Query: 124 DQIDDDASLVSSFEA----YQANDESMAMMDQWYSLESDLQYSPK 2 DQIDDD SL SSF A YQAND+SMAMMD WY + LQ SPK Sbjct: 220 DQIDDDVSLFSSFGACDDHYQANDQSMAMMDSWYGFDGLLQ-SPK 263 >KYP55175.1 Ethylene-responsive transcription factor ERF012 family [Cajanus cajan] Length = 202 Score = 51.6 bits (122), Expect = 9e-06 Identities = 26/44 (59%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = -3 Query: 124 DQIDDDASLVSSFEAYQAND---ESMAMMDQWYSLESDLQYSPK 2 DQ+DD+ASL+SSFEAY ++D ES+A+M+ WY+ DLQ SPK Sbjct: 126 DQMDDEASLISSFEAYTSSDQANESVAVMEPWYTFADDLQ-SPK 168