BLASTX nr result
ID: Glycyrrhiza36_contig00035388
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035388 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003593194.1 hypothetical protein MTR_2g008780 [Medicago trunc... 64 6e-11 XP_003602067.1 delta-aminolevulinic acid dehydratase [Medicago t... 55 1e-07 >XP_003593194.1 hypothetical protein MTR_2g008780 [Medicago truncatula] AES63445.1 hypothetical protein MTR_2g008780 [Medicago truncatula] Length = 120 Score = 63.5 bits (153), Expect = 6e-11 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = -2 Query: 227 PYPYCDSRYRFHGRVDPYTSYRAHYETXXXXXXXXXXXXQIHPFYTSESMCN 72 PYP+ DSRY FHGRVDPYTSY+A+YET +HPF+T S N Sbjct: 61 PYPFYDSRYSFHGRVDPYTSYQAYYETPLLPFPQPPPPASVHPFWTPCSCLN 112 >XP_003602067.1 delta-aminolevulinic acid dehydratase [Medicago truncatula] AES72318.1 delta-aminolevulinic acid dehydratase [Medicago truncatula] Length = 134 Score = 55.5 bits (132), Expect = 1e-07 Identities = 22/27 (81%), Positives = 25/27 (92%) Frame = -2 Query: 227 PYPYCDSRYRFHGRVDPYTSYRAHYET 147 PYP+ DSRY FHGRVDPYTSY+A+YET Sbjct: 76 PYPFYDSRYSFHGRVDPYTSYQAYYET 102