BLASTX nr result
ID: Glycyrrhiza36_contig00035150
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035150 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012575238.1 PREDICTED: uncharacterized protein LOC101489056 [... 79 3e-15 >XP_012575238.1 PREDICTED: uncharacterized protein LOC101489056 [Cicer arietinum] Length = 453 Score = 79.0 bits (193), Expect = 3e-15 Identities = 39/68 (57%), Positives = 50/68 (73%) Frame = +2 Query: 68 MAEPHSAAPPSSEANGEASPSEENAANGSQTRLLSPDLARESRRVSNALGRTSWNLAEDS 247 M+EPHS PPSS NGE S S EN++ +Q++ SPD R+SRRVS GRT W++ +DS Sbjct: 1 MSEPHST-PPSSAPNGEPSLSYENSSAATQSQSRSPDRPRDSRRVSITYGRTYWSIVDDS 59 Query: 248 AILRDDKW 271 AI+RDDKW Sbjct: 60 AIVRDDKW 67