BLASTX nr result
ID: Glycyrrhiza36_contig00035105
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035105 (294 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007138761.1 hypothetical protein PHAVU_009G2351000g, partial ... 82 1e-16 XP_014513220.1 PREDICTED: pentatricopeptide repeat-containing pr... 81 9e-16 XP_017439649.1 PREDICTED: pentatricopeptide repeat-containing pr... 80 2e-15 BAU01864.1 hypothetical protein VIGAN_11120000 [Vigna angularis ... 80 2e-15 XP_007153021.1 hypothetical protein PHAVU_003G0011000g, partial ... 80 2e-15 XP_004506730.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 3e-15 XP_007136006.1 hypothetical protein PHAVU_009G010000g [Phaseolus... 79 4e-15 GAU43070.1 hypothetical protein TSUD_194240 [Trifolium subterran... 76 1e-14 XP_003589765.1 pentatricopeptide (PPR) repeat protein [Medicago ... 72 9e-13 KHN05296.1 Putative pentatricopeptide repeat-containing protein ... 71 2e-12 XP_006601386.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 2e-12 XP_006601200.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 2e-12 XP_006586726.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 2e-12 XP_006586725.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 2e-12 XP_006586723.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 2e-12 XP_019455035.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 4e-10 XP_018848384.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-08 ONI01448.1 hypothetical protein PRUPE_6G140100 [Prunus persica] 57 2e-07 XP_019072030.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 4e-07 XP_008361455.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 56 6e-07 >XP_007138761.1 hypothetical protein PHAVU_009G2351000g, partial [Phaseolus vulgaris] ESW10755.1 hypothetical protein PHAVU_009G2351000g, partial [Phaseolus vulgaris] Length = 279 Score = 81.6 bits (200), Expect = 1e-16 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +3 Query: 150 QMSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 QMSY Q+SQ+FYDAFK CGTSLKSP IARKLHAQL+LSG D S+FLLN Sbjct: 20 QMSYMQLSQKFYDAFKQCGTSLKSPLIARKLHAQLILSGLDTSLFLLN 67 >XP_014513220.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Vigna radiata var. radiata] Length = 899 Score = 80.9 bits (198), Expect = 9e-16 Identities = 39/48 (81%), Positives = 44/48 (91%) Frame = +3 Query: 150 QMSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 QMSY ++SQ+FYDAFK CGTSLKSP IARKLHAQL+LSG DAS+FLLN Sbjct: 23 QMSYMELSQKFYDAFKLCGTSLKSPLIARKLHAQLILSGLDASLFLLN 70 >XP_017439649.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Vigna angularis] XP_017439650.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Vigna angularis] XP_017439651.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Vigna angularis] XP_017439652.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Vigna angularis] Length = 876 Score = 80.1 bits (196), Expect = 2e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CGTSLKSP IARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCGTSLKSPLIARKLHAQLILSGLDASLFLLN 47 >BAU01864.1 hypothetical protein VIGAN_11120000 [Vigna angularis var. angularis] Length = 876 Score = 80.1 bits (196), Expect = 2e-15 Identities = 39/47 (82%), Positives = 43/47 (91%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CGTSLKSP IARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCGTSLKSPLIARKLHAQLILSGLDASLFLLN 47 >XP_007153021.1 hypothetical protein PHAVU_003G0011000g, partial [Phaseolus vulgaris] ESW25015.1 hypothetical protein PHAVU_003G0011000g, partial [Phaseolus vulgaris] Length = 415 Score = 79.7 bits (195), Expect = 2e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CGTSLKSP IARKLH QL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKQCGTSLKSPLIARKLHGQLILSGLDASLFLLN 47 >XP_004506730.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Cicer arietinum] XP_004506736.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Cicer arietinum] XP_012573002.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Cicer arietinum] XP_012573003.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Cicer arietinum] XP_012573004.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Cicer arietinum] XP_012573005.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Cicer arietinum] Length = 876 Score = 79.3 bits (194), Expect = 3e-15 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +3 Query: 156 SYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 SY QISQ+FYDAFKHCG SLKSP IARKLHAQL+LSG D S+FLLN Sbjct: 3 SYMQISQKFYDAFKHCGFSLKSPHIARKLHAQLILSGLDTSLFLLN 48 >XP_007136006.1 hypothetical protein PHAVU_009G010000g [Phaseolus vulgaris] ESW08000.1 hypothetical protein PHAVU_009G010000g [Phaseolus vulgaris] Length = 804 Score = 79.0 bits (193), Expect = 4e-15 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CGTSLKSP IARKLHAQL+LS DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKQCGTSLKSPLIARKLHAQLILSSLDASLFLLN 47 >GAU43070.1 hypothetical protein TSUD_194240 [Trifolium subterraneum] Length = 278 Score = 76.3 bits (186), Expect = 1e-14 Identities = 37/47 (78%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY QISQ+FYDAFKHC S KSP IARKLHAQL+LSG D S+FLLN Sbjct: 1 MSYMQISQKFYDAFKHCSFSHKSPHIARKLHAQLILSGLDTSLFLLN 47 >XP_003589765.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES60016.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 960 Score = 72.4 bits (176), Expect = 9e-13 Identities = 35/47 (74%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY QISQ+FYDAFK C + KSP IARKLHAQL+LSG D+S+FLLN Sbjct: 1 MSYMQISQKFYDAFKQCSFTHKSPHIARKLHAQLILSGLDSSLFLLN 47 >KHN05296.1 Putative pentatricopeptide repeat-containing protein [Glycine soja] Length = 558 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CG SPPIARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCG----SPPIARKLHAQLILSGLDASLFLLN 43 >XP_006601386.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] KRH06022.1 hypothetical protein GLYMA_17G262700 [Glycine max] Length = 871 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CG SPPIARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCG----SPPIARKLHAQLILSGLDASLFLLN 43 >XP_006601200.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] XP_006601201.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Glycine max] KRH05320.1 hypothetical protein GLYMA_17G220100 [Glycine max] Length = 871 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CG SPPIARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCG----SPPIARKLHAQLILSGLDASLFLLN 43 >XP_006586726.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X4 [Glycine max] XP_014617293.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X3 [Glycine max] KRH36381.1 hypothetical protein GLYMA_09G000400 [Glycine max] Length = 871 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CG SPPIARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCG----SPPIARKLHAQLILSGLDASLFLLN 43 >XP_006586725.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X2 [Glycine max] Length = 880 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CG SPPIARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCG----SPPIARKLHAQLILSGLDASLFLLN 43 >XP_006586723.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Glycine max] XP_006586724.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Glycine max] XP_014617292.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like isoform X1 [Glycine max] Length = 892 Score = 71.2 bits (173), Expect = 2e-12 Identities = 36/47 (76%), Positives = 40/47 (85%) Frame = +3 Query: 153 MSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 MSY Q+SQ+FYDAFK CG SPPIARKLHAQL+LSG DAS+FLLN Sbjct: 1 MSYMQLSQKFYDAFKLCG----SPPIARKLHAQLILSGLDASLFLLN 43 >XP_019455035.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Lupinus angustifolius] Length = 900 Score = 64.7 bits (156), Expect = 4e-10 Identities = 33/54 (61%), Positives = 42/54 (77%) Frame = +3 Query: 132 HRTMSNQMSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 + + S +SY QISQ Y+ FKHC +SLKS PIA+KLHAQL+LSG D+S+FL N Sbjct: 23 YHSNSFHLSYMQISQNLYENFKHC-SSLKSKPIAQKLHAQLILSGLDSSLFLHN 75 >XP_018848384.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Juglans regia] XP_018848385.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Juglans regia] Length = 910 Score = 60.8 bits (146), Expect = 1e-08 Identities = 30/50 (60%), Positives = 40/50 (80%) Frame = +3 Query: 144 SNQMSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 S Q+SY ++SQ+FY+A K C T LKS PIA+KLHAQL+ +G D+S+FL N Sbjct: 38 SAQLSYMELSQKFYEAMKAC-TYLKSTPIAQKLHAQLISTGLDSSIFLQN 86 >ONI01448.1 hypothetical protein PRUPE_6G140100 [Prunus persica] Length = 858 Score = 57.4 bits (137), Expect = 2e-07 Identities = 30/50 (60%), Positives = 37/50 (74%) Frame = +3 Query: 144 SNQMSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 S Q SY ++SQ FY+A K C SLKS PIARKLHAQL+ G D+++FL N Sbjct: 41 SLQQSYMELSQTFYEAMKACA-SLKSIPIARKLHAQLISIGLDSAIFLQN 89 >XP_019072030.1 PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Vitis vinifera] Length = 853 Score = 56.2 bits (134), Expect = 4e-07 Identities = 28/51 (54%), Positives = 37/51 (72%) Frame = +3 Query: 141 MSNQMSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 M Q SY ++SQ+FY++ K C SL+S PIARKLHAQL+ G +S+FL N Sbjct: 35 MFPQQSYMEMSQKFYESMKECA-SLRSIPIARKLHAQLIFMGLKSSIFLQN 84 >XP_008361455.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g13600-like [Malus domestica] XP_008362330.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g13600-like [Malus domestica] Length = 906 Score = 55.8 bits (133), Expect = 6e-07 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +3 Query: 144 SNQMSYKQISQRFYDAFKHCGTSLKSPPIARKLHAQLMLSGWDASVFLLN 293 S Q SY ++SQ FY+A K C SLKS PIARKLH QL+ G D+++FL N Sbjct: 40 SLQQSYMELSQTFYEAMKTCA-SLKSIPIARKLHGQLISVGLDSAIFLQN 88