BLASTX nr result
ID: Glycyrrhiza36_contig00035089
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035089 (295 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013463783.1 hypothetical protein MTR_2g048385 [Medicago trunc... 56 2e-07 >XP_013463783.1 hypothetical protein MTR_2g048385 [Medicago truncatula] KEH37818.1 hypothetical protein MTR_2g048385 [Medicago truncatula] Length = 234 Score = 56.2 bits (134), Expect = 2e-07 Identities = 27/58 (46%), Positives = 32/58 (55%), Gaps = 6/58 (10%) Frame = +1 Query: 1 HPFTTAFLWRFKPEYRDVLPFSDEEEEP------FTFTQSFCFSPSVFGSATINPELV 156 H F+ AF+WRFKPEYRD++P SDEEEEP T SF P NP + Sbjct: 62 HMFSLAFIWRFKPEYRDIIPMSDEEEEPETELEWLTTQGSFDIQPQDIDQGNPNPTAI 119