BLASTX nr result
ID: Glycyrrhiza36_contig00035023
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00035023 (336 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015949820.1 PREDICTED: pentatricopeptide repeat-containing pr... 97 4e-21 XP_014511376.1 PREDICTED: pentatricopeptide repeat-containing pr... 91 7e-19 KOM34136.1 hypothetical protein LR48_Vigan02g028600 [Vigna angul... 88 4e-18 XP_017412853.1 PREDICTED: putative pentatricopeptide repeat-cont... 88 4e-18 XP_004497944.2 PREDICTED: pentatricopeptide repeat-containing pr... 87 1e-17 KYP78232.1 hypothetical protein KK1_048185 [Cajanus cajan] 80 3e-15 XP_018844027.1 PREDICTED: pentatricopeptide repeat-containing pr... 79 1e-14 GAV73941.1 PPR domain-containing protein/PPR_2 domain-containing... 77 5e-14 XP_010653936.1 PREDICTED: putative pentatricopeptide repeat-cont... 75 1e-13 GAV81758.1 PPR domain-containing protein, partial [Cephalotus fo... 71 2e-13 XP_004305697.2 PREDICTED: putative pentatricopeptide repeat-cont... 72 1e-12 KHN22361.1 Pentatricopeptide repeat-containing protein, mitochon... 67 2e-11 XP_015898019.1 PREDICTED: pentatricopeptide repeat-containing pr... 69 2e-11 XP_016651705.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 1e-09 XP_007204225.1 hypothetical protein PRUPE_ppa002924mg [Prunus pe... 64 1e-09 ONH95022.1 hypothetical protein PRUPE_7G047100, partial [Prunus ... 64 1e-09 XP_010929475.1 PREDICTED: pentatricopeptide repeat-containing pr... 64 1e-09 XP_018499673.1 PREDICTED: pentatricopeptide repeat-containing pr... 63 3e-09 XP_011093560.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-08 XP_015583544.1 PREDICTED: pentatricopeptide repeat-containing pr... 61 1e-08 >XP_015949820.1 PREDICTED: pentatricopeptide repeat-containing protein At1g11290, chloroplastic-like [Arachis duranensis] Length = 622 Score = 96.7 bits (239), Expect = 4e-21 Identities = 44/56 (78%), Positives = 50/56 (89%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDFG 168 +RR M+EKDLKKKPGWSCIEVNGVIQGFVS DISH E++E+YE LGRLS IQ+FG Sbjct: 567 MRRMMSEKDLKKKPGWSCIEVNGVIQGFVSGDISHTESEEVYETLGRLSRAIQEFG 622 >XP_014511376.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Vigna radiata var. radiata] Length = 621 Score = 90.5 bits (223), Expect = 7e-19 Identities = 44/56 (78%), Positives = 47/56 (83%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDFG 168 LRR M E+DLKKKPGWSCIEV G I+GFVS D SHPEA+EIYEALGRLS V QD G Sbjct: 566 LRRDMRERDLKKKPGWSCIEVAGSIRGFVSGDKSHPEAEEIYEALGRLSIVTQDLG 621 >KOM34136.1 hypothetical protein LR48_Vigan02g028600 [Vigna angularis] BAT96413.1 hypothetical protein VIGAN_08334900 [Vigna angularis var. angularis] Length = 621 Score = 88.2 bits (217), Expect = 4e-18 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQD 162 LRR M E+DLKKKPGWSCIEV G I+GFVS D SHPEA+EIYEALGRLS V QD Sbjct: 566 LRRDMRERDLKKKPGWSCIEVAGSIRGFVSGDKSHPEAEEIYEALGRLSIVTQD 619 >XP_017412853.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Vigna angularis] Length = 691 Score = 88.2 bits (217), Expect = 4e-18 Identities = 43/54 (79%), Positives = 46/54 (85%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQD 162 LRR M E+DLKKKPGWSCIEV G I+GFVS D SHPEA+EIYEALGRLS V QD Sbjct: 636 LRRDMRERDLKKKPGWSCIEVAGSIRGFVSGDKSHPEAEEIYEALGRLSIVTQD 689 >XP_004497944.2 PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic-like [Cicer arietinum] Length = 619 Score = 86.7 bits (213), Expect = 1e-17 Identities = 40/49 (81%), Positives = 44/49 (89%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLS 147 LRR M+EK+LKKKPGWSCIEV G IQGFVS DISHPEAD+I+E LGRLS Sbjct: 568 LRRVMSEKNLKKKPGWSCIEVKGAIQGFVSGDISHPEADKIFETLGRLS 616 >KYP78232.1 hypothetical protein KK1_048185 [Cajanus cajan] Length = 445 Score = 80.1 bits (196), Expect = 3e-15 Identities = 37/49 (75%), Positives = 42/49 (85%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLS 147 LRR M+E+DLKKKPGWSCIEVNGVI GFVS D SHPE +EI +AL RL+ Sbjct: 395 LRRVMSERDLKKKPGWSCIEVNGVIHGFVSSDKSHPETEEISKALSRLA 443 >XP_018844027.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Juglans regia] Length = 647 Score = 78.6 bits (192), Expect = 1e-14 Identities = 35/56 (62%), Positives = 43/56 (76%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDFG 168 +RR +NE+ +KKKPGWSCIE G+I GFVS D SH + DEIYE LG L +IQ+FG Sbjct: 583 VRRVVNEEYMKKKPGWSCIEAKGIIHGFVSADRSHHQVDEIYEVLGCLGRMIQEFG 638 >GAV73941.1 PPR domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 622 Score = 76.6 bits (187), Expect = 5e-14 Identities = 36/56 (64%), Positives = 42/56 (75%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDFG 168 +RR MNE +LKKKPGWSCIE+ G I GFVS D SH + D+IY+ LG LS IQ FG Sbjct: 565 VRRIMNENELKKKPGWSCIEMKGGIHGFVSADRSHNQVDKIYDLLGHLSRKIQIFG 620 >XP_010653936.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Vitis vinifera] Length = 739 Score = 75.5 bits (184), Expect = 1e-13 Identities = 34/56 (60%), Positives = 44/56 (78%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDFG 168 +RR M+E+DLKKKPGWSCIEV G+I GFVS D SH + +EI + +G L+ IQ+FG Sbjct: 680 VRRVMHERDLKKKPGWSCIEVKGMIHGFVSGDTSHHQVEEICKVVGCLNRKIQEFG 735 >GAV81758.1 PPR domain-containing protein, partial [Cephalotus follicularis] Length = 121 Score = 70.9 bits (172), Expect = 2e-13 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +1 Query: 16 NEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDFG 168 NE +LKKKPGWSCIE+ G I GFVS D SH + D+IY+ LG LS IQ FG Sbjct: 66 NENELKKKPGWSCIEMKGGIHGFVSADRSHNQVDKIYDLLGHLSRKIQIFG 116 >XP_004305697.2 PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580, partial [Fragaria vesca subsp. vesca] Length = 727 Score = 72.4 bits (176), Expect = 1e-12 Identities = 34/52 (65%), Positives = 38/52 (73%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVI 156 +RR M E DLKKKPGWSCIE G+I GFVS D SH +EIYE LG LS +I Sbjct: 676 IRRTMKENDLKKKPGWSCIEAKGLIHGFVSGDNSHHHIEEIYEVLGCLSRLI 727 >KHN22361.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 200 Score = 67.4 bits (163), Expect = 2e-11 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSV 153 LR+ ++E+ LKKKP SCIEV I GFVS + SHPEA+EIYEALGRLS V Sbjct: 135 LRKVISERGLKKKPRRSCIEVTEGIHGFVSSNKSHPEAEEIYEALGRLSRV 185 >XP_015898019.1 PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic-like, partial [Ziziphus jujuba] XP_015898125.1 PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic-like, partial [Ziziphus jujuba] XP_015900594.1 PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic-like, partial [Ziziphus jujuba] Length = 741 Score = 69.3 bits (168), Expect = 2e-11 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDF 165 +RR M EK++KKKPGWSCIE G + GFVS D SH + +EIY LG LS +I+ F Sbjct: 686 IRRVMKEKEMKKKPGWSCIENKGRVYGFVSGDRSHHQTEEIYGVLGCLSRMIKGF 740 >XP_016651705.1 PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic [Prunus mume] Length = 621 Score = 64.3 bits (155), Expect = 1e-09 Identities = 33/56 (58%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEV-NGVIQGFVSRDISHPEADEIYEALGRLSSVIQDF 165 +RR M E+DLKKKPGWSCIE G I GFVS D SH + + IYE L LS + Q F Sbjct: 565 IRRVMKERDLKKKPGWSCIEAEEGRIYGFVSGDRSHHQMEAIYEVLEYLSRMAQGF 620 >XP_007204225.1 hypothetical protein PRUPE_ppa002924mg [Prunus persica] Length = 621 Score = 63.9 bits (154), Expect = 1e-09 Identities = 32/56 (57%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEV-NGVIQGFVSRDISHPEADEIYEALGRLSSVIQDF 165 +RR M E+DLKKKPGWSCIE G I GFVS D SH + + +YE L LS + Q F Sbjct: 565 IRRVMKERDLKKKPGWSCIEAEEGRIYGFVSGDRSHHQMEAVYEVLEYLSRMAQGF 620 >ONH95022.1 hypothetical protein PRUPE_7G047100, partial [Prunus persica] Length = 680 Score = 63.9 bits (154), Expect = 1e-09 Identities = 32/56 (57%), Positives = 38/56 (67%), Gaps = 1/56 (1%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEV-NGVIQGFVSRDISHPEADEIYEALGRLSSVIQDF 165 +RR M E+DLKKKPGWSCIE G I GFVS D SH + + +YE L LS + Q F Sbjct: 624 IRRVMKERDLKKKPGWSCIEAEEGRIYGFVSGDRSHHQMEAVYEVLEYLSRMAQGF 679 >XP_010929475.1 PREDICTED: pentatricopeptide repeat-containing protein At4g35130, chloroplastic-like [Elaeis guineensis] Length = 692 Score = 63.9 bits (154), Expect = 1e-09 Identities = 29/54 (53%), Positives = 39/54 (72%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQD 162 +R+ M EK ++PGWSCIE G +Q FV+ D SHP+A EIYEALG LS +++ Sbjct: 620 IRKFMGEKGFVRRPGWSCIEEKGGLQMFVAGDRSHPQAGEIYEALGCLSKCMEE 673 >XP_018499673.1 PREDICTED: pentatricopeptide repeat-containing protein At1g50270 isoform X1 [Pyrus x bretschneideri] Length = 479 Score = 62.8 bits (151), Expect = 3e-09 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = +1 Query: 4 RRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEAL 135 RR M+E DLKK PGWSCIE G I GFVS D SH + +EIYE L Sbjct: 429 RRVMSEMDLKKMPGWSCIEAEGRIYGFVSGDRSHHQVEEIYEVL 472 >XP_011093560.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Sesamum indicum] Length = 537 Score = 61.2 bits (147), Expect = 1e-08 Identities = 26/45 (57%), Positives = 36/45 (80%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEAL 135 +RR + +K LKKKPG S IEVNG+++ FV+ D+SHP+AD+IY L Sbjct: 471 VRRLIQKKQLKKKPGCSAIEVNGIVEEFVAGDVSHPQADDIYRIL 515 >XP_015583544.1 PREDICTED: pentatricopeptide repeat-containing protein At4g33990 [Ricinus communis] Length = 715 Score = 61.2 bits (147), Expect = 1e-08 Identities = 27/56 (48%), Positives = 40/56 (71%) Frame = +1 Query: 1 LRRAMNEKDLKKKPGWSCIEVNGVIQGFVSRDISHPEADEIYEALGRLSSVIQDFG 168 +R+ ++EKDL+K PGWSCI G F+S D +H +A+EIY+ L LS+ +Q+FG Sbjct: 658 VRKVIHEKDLRKTPGWSCIVGKGRNYCFISGDRTHKQAEEIYDVLRHLSTKVQEFG 713