BLASTX nr result
ID: Glycyrrhiza36_contig00034889
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00034889 (265 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN28335.1 Scarecrow-like protein 32 [Glycine soja] 73 1e-13 KHN06002.1 Scarecrow-like protein 32 [Glycine soja] 73 2e-13 KYP55207.1 Scarecrow-like protein 32 [Cajanus cajan] 73 3e-13 KRH58051.1 hypothetical protein GLYMA_05G103400 [Glycine max] 73 3e-13 CCH47195.1 similar to GRAS family transcription factor [Lupinus ... 73 3e-13 XP_019416185.1 PREDICTED: scarecrow-like protein 32 [Lupinus ang... 73 3e-13 XP_003608476.1 GRAS family transcription factor [Medicago trunca... 73 3e-13 XP_003550980.1 PREDICTED: scarecrow-like protein 32 [Glycine max... 73 3e-13 KRH58050.1 hypothetical protein GLYMA_05G103400 [Glycine max] 73 3e-13 XP_004509074.2 PREDICTED: scarecrow-like protein 32 [Cicer ariet... 73 3e-13 XP_003611618.1 GRAS family transcription factor [Medicago trunca... 72 7e-13 XP_014508241.1 PREDICTED: scarecrow-like protein 32 [Vigna radia... 72 8e-13 GAU49239.1 hypothetical protein TSUD_183300 [Trifolium subterran... 72 1e-12 XP_007155843.1 hypothetical protein PHAVU_003G236300g [Phaseolus... 71 2e-12 KOM32402.1 hypothetical protein LR48_Vigan01g195800 [Vigna angul... 70 3e-12 XP_017428317.1 PREDICTED: scarecrow-like protein 32 [Vigna angul... 70 3e-12 XP_011013595.1 PREDICTED: putative scarecrow-like protein 16 iso... 70 3e-12 XP_011013594.1 PREDICTED: scarecrow-like protein 32 isoform X1 [... 70 4e-12 XP_011099354.1 PREDICTED: scarecrow-like protein 32 [Sesamum ind... 70 4e-12 XP_006380635.1 hypothetical protein POPTR_0007s10030g [Populus t... 70 4e-12 >KHN28335.1 Scarecrow-like protein 32 [Glycine soja] Length = 261 Score = 73.2 bits (178), Expect = 1e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 229 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 261 >KHN06002.1 Scarecrow-like protein 32 [Glycine soja] Length = 350 Score = 73.2 bits (178), Expect = 2e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 318 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 350 >KYP55207.1 Scarecrow-like protein 32 [Cajanus cajan] Length = 419 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 387 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 419 >KRH58051.1 hypothetical protein GLYMA_05G103400 [Glycine max] Length = 424 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 392 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 424 >CCH47195.1 similar to GRAS family transcription factor [Lupinus angustifolius] OIV97388.1 hypothetical protein TanjilG_17572 [Lupinus angustifolius] Length = 445 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 413 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 445 >XP_019416185.1 PREDICTED: scarecrow-like protein 32 [Lupinus angustifolius] Length = 468 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 436 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 468 >XP_003608476.1 GRAS family transcription factor [Medicago truncatula] AES90673.1 GRAS family transcription factor [Medicago truncatula] Length = 470 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 438 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 470 >XP_003550980.1 PREDICTED: scarecrow-like protein 32 [Glycine max] KRH04459.1 hypothetical protein GLYMA_17G162800 [Glycine max] Length = 482 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 450 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 482 >KRH58050.1 hypothetical protein GLYMA_05G103400 [Glycine max] Length = 525 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 493 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 525 >XP_004509074.2 PREDICTED: scarecrow-like protein 32 [Cicer arietinum] Length = 556 Score = 73.2 bits (178), Expect = 3e-13 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE++VLTWKGHNV+FASAWLPA Sbjct: 524 EHAAGWGLKKEDEHIVLTWKGHNVVFASAWLPA 556 >XP_003611618.1 GRAS family transcription factor [Medicago truncatula] XP_013459850.1 GRAS family transcription factor [Medicago truncatula] AES94576.1 GRAS family transcription factor [Medicago truncatula] KEH33881.1 GRAS family transcription factor [Medicago truncatula] Length = 448 Score = 72.0 bits (175), Expect = 7e-13 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHA GWGLKKEDE+LVLTWKGHNVIFASAWLP+ Sbjct: 416 EHAVGWGLKKEDEFLVLTWKGHNVIFASAWLPS 448 >XP_014508241.1 PREDICTED: scarecrow-like protein 32 [Vigna radiata var. radiata] Length = 470 Score = 72.0 bits (175), Expect = 8e-13 Identities = 29/33 (87%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLK+EDE++VLTWKGHNV+FASAWLPA Sbjct: 438 EHAAGWGLKREDEHIVLTWKGHNVVFASAWLPA 470 >GAU49239.1 hypothetical protein TSUD_183300 [Trifolium subterraneum] Length = 439 Score = 71.6 bits (174), Expect = 1e-12 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE +VLTWKGHNV+FASAWLPA Sbjct: 407 EHAAGWGLKKEDECIVLTWKGHNVVFASAWLPA 439 >XP_007155843.1 hypothetical protein PHAVU_003G236300g [Phaseolus vulgaris] ESW27837.1 hypothetical protein PHAVU_003G236300g [Phaseolus vulgaris] Length = 470 Score = 70.9 bits (172), Expect = 2e-12 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLK+EDE+++LTWKGHNV+FASAWLPA Sbjct: 438 EHAAGWGLKREDEHILLTWKGHNVVFASAWLPA 470 >KOM32402.1 hypothetical protein LR48_Vigan01g195800 [Vigna angularis] Length = 453 Score = 70.5 bits (171), Expect = 3e-12 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLP 168 EHAAGWGLK+EDE++VLTWKGHNV+FASAWLP Sbjct: 421 EHAAGWGLKREDEHIVLTWKGHNVVFASAWLP 452 >XP_017428317.1 PREDICTED: scarecrow-like protein 32 [Vigna angularis] BAT75672.1 hypothetical protein VIGAN_01357500 [Vigna angularis var. angularis] Length = 470 Score = 70.5 bits (171), Expect = 3e-12 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLP 168 EHAAGWGLK+EDE++VLTWKGHNV+FASAWLP Sbjct: 438 EHAAGWGLKREDEHIVLTWKGHNVVFASAWLP 469 >XP_011013595.1 PREDICTED: putative scarecrow-like protein 16 isoform X2 [Populus euphratica] Length = 341 Score = 70.1 bits (170), Expect = 3e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKED+ +VLTWKGHNV+FASAWLPA Sbjct: 309 EHAAGWGLKKEDDDIVLTWKGHNVVFASAWLPA 341 >XP_011013594.1 PREDICTED: scarecrow-like protein 32 isoform X1 [Populus euphratica] Length = 429 Score = 70.1 bits (170), Expect = 4e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKED+ +VLTWKGHNV+FASAWLPA Sbjct: 397 EHAAGWGLKKEDDDIVLTWKGHNVVFASAWLPA 429 >XP_011099354.1 PREDICTED: scarecrow-like protein 32 [Sesamum indicum] Length = 450 Score = 70.1 bits (170), Expect = 4e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKEDE LVLTWKGHNV+FA+AW+PA Sbjct: 418 EHAAGWGLKKEDEDLVLTWKGHNVVFATAWIPA 450 >XP_006380635.1 hypothetical protein POPTR_0007s10030g [Populus trichocarpa] ERP58432.1 hypothetical protein POPTR_0007s10030g [Populus trichocarpa] Length = 451 Score = 70.1 bits (170), Expect = 4e-12 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -3 Query: 263 EHAAGWGLKKEDEYLVLTWKGHNVIFASAWLPA 165 EHAAGWGLKKED+ +VLTWKGHNV+FASAWLPA Sbjct: 419 EHAAGWGLKKEDDDIVLTWKGHNVVFASAWLPA 451