BLASTX nr result
ID: Glycyrrhiza36_contig00034846
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00034846 (543 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004152148.1 PREDICTED: inositol polyphosphate multikinase alp... 56 5e-06 XP_008454112.1 PREDICTED: inositol polyphosphate multikinase bet... 55 6e-06 XP_003627882.1 inositol polyphosphate multikinase beta-like prot... 55 8e-06 >XP_004152148.1 PREDICTED: inositol polyphosphate multikinase alpha [Cucumis sativus] XP_011653019.1 PREDICTED: inositol polyphosphate multikinase alpha [Cucumis sativus] KGN52989.1 hypothetical protein Csa_4G009900 [Cucumis sativus] Length = 305 Score = 55.8 bits (133), Expect = 5e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 538 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYI 425 HPHLVLEDL+S Y NP+I+DI+IGS+T P AS +DYI Sbjct: 81 HPHLVLEDLISNYENPTIVDIKIGSRTWYPQAS-EDYI 117 >XP_008454112.1 PREDICTED: inositol polyphosphate multikinase beta-like [Cucumis melo] XP_008454113.1 PREDICTED: inositol polyphosphate multikinase beta-like [Cucumis melo] Length = 305 Score = 55.5 bits (132), Expect = 6e-06 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -3 Query: 538 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYI 425 HPHLVLEDL+S Y NPSI+DI+IGS+T P AS ++YI Sbjct: 81 HPHLVLEDLISNYENPSIVDIKIGSRTWYPQAS-EEYI 117 >XP_003627882.1 inositol polyphosphate multikinase beta-like protein [Medicago truncatula] AET02358.1 inositol polyphosphate multikinase beta-like protein [Medicago truncatula] Length = 426 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/38 (63%), Positives = 33/38 (86%) Frame = -3 Query: 538 HPHLVLEDLVSGYANPSIIDIEIGSQTCNPNASNDDYI 425 HPHLVLED+VS Y NP+++DI+IGS+T +P S++DYI Sbjct: 223 HPHLVLEDIVSNYTNPAVVDIKIGSRTWHPQ-SSEDYI 259