BLASTX nr result
ID: Glycyrrhiza36_contig00034755
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00034755 (218 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU42108.1 hypothetical protein TSUD_350820 [Trifolium subterran... 65 1e-10 XP_004510494.1 PREDICTED: formin-like protein 18 [Cicer arietinum] 59 1e-08 XP_003627209.1 hydroxyproline-rich glycoprotein family protein [... 54 1e-06 XP_003529823.1 PREDICTED: verprolin-like [Glycine max] KHN01377.... 52 7e-06 >GAU42108.1 hypothetical protein TSUD_350820 [Trifolium subterraneum] Length = 604 Score = 65.1 bits (157), Expect = 1e-10 Identities = 35/55 (63%), Positives = 40/55 (72%) Frame = -3 Query: 192 SVFHNLFSSKKSKHKTHYLVPVATYKPQSSNKREHSHNYSLEDKNKNVMVTGNES 28 SVF +LFSS KSKHK HY VPVATYKPQ NKRE S NY L++ ++ GNES Sbjct: 430 SVFQSLFSSNKSKHKKHYHVPVATYKPQLPNKREQS-NYRLKEN----VIIGNES 479 >XP_004510494.1 PREDICTED: formin-like protein 18 [Cicer arietinum] Length = 595 Score = 59.3 bits (142), Expect = 1e-08 Identities = 35/55 (63%), Positives = 39/55 (70%) Frame = -3 Query: 192 SVFHNLFSSKKSKHKTHYLVPVATYKPQSSNKREHSHNYSLEDKNKNVMVTGNES 28 SVFHNLFSS KSKHK HYLVP+A KR+HS Y L+D N NVM +GNES Sbjct: 427 SVFHNLFSSNKSKHKKHYLVPMA------PPKRDHS-QYRLKD-NVNVMNSGNES 473 >XP_003627209.1 hydroxyproline-rich glycoprotein family protein [Medicago truncatula] AET01685.1 hydroxyproline-rich glycoprotein family protein [Medicago truncatula] Length = 684 Score = 53.9 bits (128), Expect = 1e-06 Identities = 33/56 (58%), Positives = 39/56 (69%) Frame = -3 Query: 195 SSVFHNLFSSKKSKHKTHYLVPVATYKPQSSNKREHSHNYSLEDKNKNVMVTGNES 28 +SVFHNLF+S KSKHK YLVP+A RE+S NY LE KNV++TGNES Sbjct: 514 ASVFHNLFTSNKSKHKKTYLVPMA---------RENS-NYRLE---KNVVMTGNES 556 >XP_003529823.1 PREDICTED: verprolin-like [Glycine max] KHN01377.1 hypothetical protein glysoja_009583 [Glycine soja] KRH47529.1 hypothetical protein GLYMA_07G035200 [Glycine max] Length = 590 Score = 51.6 bits (122), Expect = 7e-06 Identities = 27/54 (50%), Positives = 33/54 (61%) Frame = -3 Query: 189 VFHNLFSSKKSKHKTHYLVPVATYKPQSSNKREHSHNYSLEDKNKNVMVTGNES 28 VF NLFS KK KHK ++ VAT SNKR+H + L+D NV + GNES Sbjct: 408 VFQNLFSLKKGKHKNRHIASVATTTTSVSNKRDHGSSSRLQD---NVTMAGNES 458