BLASTX nr result
ID: Glycyrrhiza36_contig00034453
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00034453 (379 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013468543.1 myosin motor domain protein and Dil domain protei... 42 5e-07 >XP_013468543.1 myosin motor domain protein and Dil domain protein [Medicago truncatula] KEH42580.1 myosin motor domain protein and Dil domain protein [Medicago truncatula] Length = 1155 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 23/40 (57%), Positives = 27/40 (67%) Frame = -2 Query: 246 DQDLKVKRKVRLMISSSKTCFFGLA*ILIFSLVSGETRKK 127 D+DL+VK+KVRLMISSSKTC + SGET KK Sbjct: 1106 DKDLEVKKKVRLMISSSKTCVSSIWLKFSSPPASGETTKK 1145 Score = 38.9 bits (89), Expect(2) = 5e-07 Identities = 21/31 (67%), Positives = 24/31 (77%) Frame = -1 Query: 343 FTFPAPASNPEAVSSSKPKPYQLVVQDVTAA 251 FTFPAP +N EA+SS+ QLVVQDVTAA Sbjct: 1066 FTFPAPVANSEALSST-----QLVVQDVTAA 1091