BLASTX nr result
ID: Glycyrrhiza36_contig00034237
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00034237 (238 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU19291.1 hypothetical protein TSUD_335770 [Trifolium subterran... 73 2e-14 XP_013459289.1 hypothetical protein MTR_3g435560 [Medicago trunc... 50 4e-06 >GAU19291.1 hypothetical protein TSUD_335770 [Trifolium subterraneum] Length = 161 Score = 72.8 bits (177), Expect = 2e-14 Identities = 35/35 (100%), Positives = 35/35 (100%) Frame = -1 Query: 238 AAQSLACSLRIGYTSGTLNTKPISKKKVNYTQLHL 134 AAQSLACSLRIGYTSGTLNTKPISKKKVNYTQLHL Sbjct: 127 AAQSLACSLRIGYTSGTLNTKPISKKKVNYTQLHL 161 >XP_013459289.1 hypothetical protein MTR_3g435560 [Medicago truncatula] KEH33320.1 hypothetical protein MTR_3g435560 [Medicago truncatula] Length = 111 Score = 50.4 bits (119), Expect = 4e-06 Identities = 24/28 (85%), Positives = 26/28 (92%) Frame = -1 Query: 238 AAQSLACSLRIGYTSGTLNTKPISKKKV 155 A QSLACS+RIGYTSGTL TKPISKKK+ Sbjct: 24 ATQSLACSVRIGYTSGTLITKPISKKKL 51