BLASTX nr result
ID: Glycyrrhiza36_contig00033957
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00033957 (318 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004508428.1 PREDICTED: pentatricopeptide repeat-containing pr... 154 2e-41 KYP73317.1 hypothetical protein KK1_005937 [Cajanus cajan] 144 4e-38 XP_013454357.1 PPR containing plant-like protein [Medicago trunc... 133 5e-34 XP_003617308.2 PPR containing plant-like protein [Medicago trunc... 133 5e-34 XP_003518493.2 PREDICTED: pentatricopeptide repeat-containing pr... 130 5e-33 XP_014504345.1 PREDICTED: pentatricopeptide repeat-containing pr... 129 1e-32 XP_017429853.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 3e-32 XP_007141459.1 hypothetical protein PHAVU_008G197500g [Phaseolus... 126 1e-31 XP_016166038.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 5e-29 XP_016166037.1 PREDICTED: pentatricopeptide repeat-containing pr... 119 5e-29 XP_015973238.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 9e-29 XP_015973236.1 PREDICTED: pentatricopeptide repeat-containing pr... 118 1e-28 OIW02830.1 hypothetical protein TanjilG_29606 [Lupinus angustifo... 117 3e-28 XP_013448466.1 PPR containing plant-like protein [Medicago trunc... 116 5e-28 XP_015901825.1 PREDICTED: pentatricopeptide repeat-containing pr... 105 2e-24 XP_009791185.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 9e-23 XP_016500105.1 PREDICTED: pentatricopeptide repeat-containing pr... 101 9e-23 XP_018626240.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-22 XP_018626231.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-22 XP_016502873.1 PREDICTED: pentatricopeptide repeat-containing pr... 100 3e-22 >XP_004508428.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Cicer arietinum] XP_004508429.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Cicer arietinum] XP_004508430.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Cicer arietinum] Length = 712 Score = 154 bits (388), Expect = 2e-41 Identities = 81/97 (83%), Positives = 86/97 (88%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAESESDTEWERLLKPFDLK 207 MLKTLKS IHV+R I VC KI SFPLC STA LGKN N N+ E+ESDTEWER+LKPFDLK Sbjct: 1 MLKTLKSPIHVTRTISVCIKIHSFPLC-STA-LGKNFNDNEPETESDTEWERVLKPFDLK 58 Query: 208 QLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 LQRSLNPITPSQLCKLL+LPLDIPTSMELFEKAGSQ Sbjct: 59 HLQRSLNPITPSQLCKLLELPLDIPTSMELFEKAGSQ 95 >KYP73317.1 hypothetical protein KK1_005937 [Cajanus cajan] Length = 719 Score = 144 bits (364), Expect = 4e-38 Identities = 73/97 (75%), Positives = 83/97 (85%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAESESDTEWERLLKPFDLK 207 MLKTLKSS HVSR IL+CFKIPSF LC T N N ND ES++DTEWERLLKPFDLK Sbjct: 1 MLKTLKSSTHVSRTILLCFKIPSFSLC--TIAHVNNFNDNDPESDTDTEWERLLKPFDLK 58 Query: 208 QLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 QL+RSL PI+PSQLCKLL+LPLDIPTS+ELF++AG+Q Sbjct: 59 QLRRSLTPISPSQLCKLLELPLDIPTSLELFQRAGAQ 95 >XP_013454357.1 PPR containing plant-like protein [Medicago truncatula] KEH28388.1 PPR containing plant-like protein [Medicago truncatula] Length = 704 Score = 133 bits (334), Expect = 5e-34 Identities = 69/97 (71%), Positives = 75/97 (77%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAESESDTEWERLLKPFDLK 207 MLKT KSS SR +LVC KI SFPLC +T PLGKN DTEWE LLKP+DLK Sbjct: 1 MLKTFKSSFGFSRTLLVCIKIQSFPLC-TTTPLGKN---------DDTEWENLLKPYDLK 50 Query: 208 QLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 LQRSLNPITPSQLCKLL+LPLD+PTSM+LFEKAG Q Sbjct: 51 HLQRSLNPITPSQLCKLLELPLDVPTSMDLFEKAGLQ 87 >XP_003617308.2 PPR containing plant-like protein [Medicago truncatula] AET00267.2 PPR containing plant-like protein [Medicago truncatula] Length = 782 Score = 133 bits (334), Expect = 5e-34 Identities = 69/97 (71%), Positives = 75/97 (77%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAESESDTEWERLLKPFDLK 207 MLKT KSS SR +LVC KI SFPLC +T PLGKN DTEWE LLKP+DLK Sbjct: 1 MLKTFKSSFGFSRTLLVCIKIQSFPLC-TTTPLGKN---------DDTEWENLLKPYDLK 50 Query: 208 QLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 LQRSLNPITPSQLCKLL+LPLD+PTSM+LFEKAG Q Sbjct: 51 HLQRSLNPITPSQLCKLLELPLDVPTSMDLFEKAGLQ 87 >XP_003518493.2 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Glycine max] KRH73580.1 hypothetical protein GLYMA_02G281800 [Glycine max] Length = 739 Score = 130 bits (327), Expect = 5e-33 Identities = 70/107 (65%), Positives = 83/107 (77%), Gaps = 10/107 (9%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAESES--------DTEWER 183 MLKT K SIHV+R +L+CFKIPSFPLC S N + N+AES S +TEWER Sbjct: 1 MLKTFKLSIHVNRTMLLCFKIPSFPLCTSAPETNFNDH-NEAESSSSSSSSSDNETEWER 59 Query: 184 LLKPFDLKQLQRSLN--PITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 LLKPFDLKQL+RSL+ PI+P QLCKLL+LPLDIPTSMELF++AG+Q Sbjct: 60 LLKPFDLKQLRRSLSLTPISPFQLCKLLELPLDIPTSMELFQRAGAQ 106 >XP_014504345.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] XP_014504346.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] XP_014504347.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] XP_014504348.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] XP_014504349.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] XP_014504350.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] XP_014504351.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] XP_014504352.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna radiata var. radiata] Length = 741 Score = 129 bits (324), Expect = 1e-32 Identities = 69/98 (70%), Positives = 83/98 (84%), Gaps = 1/98 (1%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAES-ESDTEWERLLKPFDL 204 MLKT KSS +VSR+ L+ FKIP FPLC +TAP G N + N+ ES +++TEWERLLKPFDL Sbjct: 1 MLKTFKSSTNVSRVSLLRFKIPFFPLC-TTAP-GSNLHDNECESSDTETEWERLLKPFDL 58 Query: 205 KQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 KQL+RSL PI+P QLCKLL LPLDIPTSMELF++AG+Q Sbjct: 59 KQLRRSLAPISPFQLCKLLVLPLDIPTSMELFQRAGAQ 96 >XP_017429853.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna angularis] XP_017429854.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna angularis] XP_017429855.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna angularis] XP_017429856.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna angularis] XP_017429857.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Vigna angularis] KOM46601.1 hypothetical protein LR48_Vigan07g030500 [Vigna angularis] BAT80825.1 hypothetical protein VIGAN_03043600 [Vigna angularis var. angularis] Length = 729 Score = 128 bits (321), Expect = 3e-32 Identities = 69/98 (70%), Positives = 82/98 (83%), Gaps = 1/98 (1%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAES-ESDTEWERLLKPFDL 204 MLKT KSS +VSR+ L+ FKIP FPLC +TAP G N N+ ES +++TEWERLLKPFDL Sbjct: 1 MLKTFKSSTNVSRVSLLRFKIPFFPLC-TTAP-GSNLYDNECESSDTETEWERLLKPFDL 58 Query: 205 KQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 KQL+RSL PI+P QLCKLL LPLDIPTSMELF++AG+Q Sbjct: 59 KQLRRSLAPISPFQLCKLLVLPLDIPTSMELFQRAGAQ 96 >XP_007141459.1 hypothetical protein PHAVU_008G197500g [Phaseolus vulgaris] ESW13453.1 hypothetical protein PHAVU_008G197500g [Phaseolus vulgaris] Length = 721 Score = 126 bits (317), Expect = 1e-31 Identities = 67/98 (68%), Positives = 79/98 (80%), Gaps = 1/98 (1%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAES-ESDTEWERLLKPFDL 204 ML+T K S +VSR+ L+ KIP FPLC TA G N N N+ ES +S+TEWERLLKPFDL Sbjct: 1 MLETFKFSSNVSRVTLLRLKIPFFPLC--TAAPGSNLNDNECESSDSETEWERLLKPFDL 58 Query: 205 KQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 KQL+RSL PI+P QLCKLL LPLDIPTSMELF++AG+Q Sbjct: 59 KQLRRSLTPISPFQLCKLLVLPLDIPTSMELFQRAGAQ 96 >XP_016166038.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X2 [Arachis ipaensis] Length = 625 Score = 119 bits (297), Expect = 5e-29 Identities = 70/102 (68%), Positives = 78/102 (76%), Gaps = 5/102 (4%) Frame = +1 Query: 28 MLKTLKSS-IHVSRIILVCFKIPSFPLCISTAP-LG--KNPNCNDAESES-DTEWERLLK 192 MLK+ KSS IHV R IL KI SFPLC +T LG K+ + AE ES D EWERLLK Sbjct: 1 MLKSFKSSTIHVHRTILFSVKIASFPLCTTTTTTLGAKKDQFWDSAEEESSDNEWERLLK 60 Query: 193 PFDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 PF LKQL+ SL+PI+PSQLCKLL LPLDIPT+MELFEKAGSQ Sbjct: 61 PFGLKQLRSSLSPISPSQLCKLLLLPLDIPTTMELFEKAGSQ 102 >XP_016166037.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X1 [Arachis ipaensis] Length = 733 Score = 119 bits (297), Expect = 5e-29 Identities = 70/102 (68%), Positives = 78/102 (76%), Gaps = 5/102 (4%) Frame = +1 Query: 28 MLKTLKSS-IHVSRIILVCFKIPSFPLCISTAP-LG--KNPNCNDAESES-DTEWERLLK 192 MLK+ KSS IHV R IL KI SFPLC +T LG K+ + AE ES D EWERLLK Sbjct: 1 MLKSFKSSTIHVHRTILFSVKIASFPLCTTTTTTLGAKKDQFWDSAEEESSDNEWERLLK 60 Query: 193 PFDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 PF LKQL+ SL+PI+PSQLCKLL LPLDIPT+MELFEKAGSQ Sbjct: 61 PFGLKQLRSSLSPISPSQLCKLLLLPLDIPTTMELFEKAGSQ 102 >XP_015973238.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X2 [Arachis duranensis] Length = 626 Score = 118 bits (295), Expect = 9e-29 Identities = 69/103 (66%), Positives = 78/103 (75%), Gaps = 6/103 (5%) Frame = +1 Query: 28 MLKTLKSS-IHVSRIILVCFKIPSFPLCISTAP--LG--KNPNCNDAESES-DTEWERLL 189 MLK+ KSS +HV R IL KI SFPLC +T LG K+ + AE ES D EWERLL Sbjct: 1 MLKSFKSSTVHVHRTILFSVKIASFPLCTTTTTTTLGAKKDQFWDSAEEESSDNEWERLL 60 Query: 190 KPFDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 KPF LKQL+ SL+PI+PSQLCKLL LPLDIPT+MELFEKAGSQ Sbjct: 61 KPFGLKQLRSSLSPISPSQLCKLLLLPLDIPTTMELFEKAGSQ 103 >XP_015973236.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial isoform X1 [Arachis duranensis] Length = 734 Score = 118 bits (295), Expect = 1e-28 Identities = 69/103 (66%), Positives = 78/103 (75%), Gaps = 6/103 (5%) Frame = +1 Query: 28 MLKTLKSS-IHVSRIILVCFKIPSFPLCISTAP--LG--KNPNCNDAESES-DTEWERLL 189 MLK+ KSS +HV R IL KI SFPLC +T LG K+ + AE ES D EWERLL Sbjct: 1 MLKSFKSSTVHVHRTILFSVKIASFPLCTTTTTTTLGAKKDQFWDSAEEESSDNEWERLL 60 Query: 190 KPFDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 KPF LKQL+ SL+PI+PSQLCKLL LPLDIPT+MELFEKAGSQ Sbjct: 61 KPFGLKQLRSSLSPISPSQLCKLLLLPLDIPTTMELFEKAGSQ 103 >OIW02830.1 hypothetical protein TanjilG_29606 [Lupinus angustifolius] Length = 715 Score = 117 bits (292), Expect = 3e-28 Identities = 65/97 (67%), Positives = 72/97 (74%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAESESDTEWERLLKPFDLK 207 MLKT KSS H++ L+ FKI SFPL ST L N ND + DT+WERLLKPFD K Sbjct: 1 MLKTFKSSSHLTTTTLIRFKIQSFPL--STTTLDNNDWIND--NSIDTDWERLLKPFDHK 56 Query: 208 QLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 QL RSLNPI+P QL KLLQLPLDIPTSMELFEK G+Q Sbjct: 57 QLLRSLNPISPIQLSKLLQLPLDIPTSMELFEKVGAQ 93 >XP_013448466.1 PPR containing plant-like protein [Medicago truncatula] KEH22493.1 PPR containing plant-like protein [Medicago truncatula] Length = 1071 Score = 116 bits (290), Expect = 5e-28 Identities = 61/97 (62%), Positives = 69/97 (71%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAESESDTEWERLLKPFDLK 207 MLKT KSSI +SR IL+C KI SF C +T+ + N EWE L KP+DLK Sbjct: 1 MLKTFKSSIGLSRTILLCIKIQSFSQCTTTSLVKNNGK----------EWENLFKPYDLK 50 Query: 208 QLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 LQRSLNPITPSQLCKLL+LPLD PTSM+LFEKAG Q Sbjct: 51 HLQRSLNPITPSQLCKLLELPLDFPTSMDLFEKAGLQ 87 >XP_015901825.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Ziziphus jujuba] XP_015902254.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Ziziphus jujuba] XP_015902255.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Ziziphus jujuba] Length = 723 Score = 105 bits (263), Expect = 2e-24 Identities = 57/98 (58%), Positives = 69/98 (70%), Gaps = 1/98 (1%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLC-ISTAPLGKNPNCNDAESESDTEWERLLKPFDL 204 MLK K + HVS+ + FKIP F +C + N + ND SES+ EW RLLKPFDL Sbjct: 1 MLKRPKLTNHVSKSLQSLFKIPCFAICSVGGVKDSINAHKNDNASESENEWVRLLKPFDL 60 Query: 205 KQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 KQL++SL ITP QL KLLQLP+D+PTSME+FE AGSQ Sbjct: 61 KQLRKSLTGITPFQLFKLLQLPIDVPTSMEIFEWAGSQ 98 >XP_009791185.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial [Nicotiana sylvestris] Length = 668 Score = 101 bits (251), Expect = 9e-23 Identities = 57/101 (56%), Positives = 67/101 (66%), Gaps = 4/101 (3%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAE----SESDTEWERLLKP 195 MLK K IH+ + +K PSF C + C +A+ SES+ EWERLLKP Sbjct: 1 MLKRSKLLIHIREELGTLYKNPSFAFCTCMT----DDKCGNAKGSGGSESENEWERLLKP 56 Query: 196 FDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 F+LKQLQRSLN ITP QL KLL LPLD+PTSMELF+ AGSQ Sbjct: 57 FNLKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQWAGSQ 97 >XP_016500105.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] Length = 717 Score = 101 bits (251), Expect = 9e-23 Identities = 57/101 (56%), Positives = 67/101 (66%), Gaps = 4/101 (3%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAE----SESDTEWERLLKP 195 MLK K IH+ + +K PSF C + C +A+ SES+ EWERLLKP Sbjct: 1 MLKRSKLLIHIREELGTLYKNPSFAFCTCMT----DDKCGNAKGSGGSESENEWERLLKP 56 Query: 196 FDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 F+LKQLQRSLN ITP QL KLL LPLD+PTSMELF+ AGSQ Sbjct: 57 FNLKQLQRSLNKITPYQLNKLLALPLDVPTSMELFQWAGSQ 97 >XP_018626240.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X2 [Nicotiana tomentosiformis] Length = 678 Score = 99.8 bits (247), Expect = 3e-22 Identities = 56/101 (55%), Positives = 67/101 (66%), Gaps = 4/101 (3%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAE----SESDTEWERLLKP 195 MLK K IH+ + +K PSF C + C +A+ SES+ EWERLLKP Sbjct: 11 MLKRSKLLIHIREELGTLYKNPSFAFCTCMT----DDKCGNAKGSGGSESENEWERLLKP 66 Query: 196 FDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 F+LKQL+RSLN ITP QL KLL LPLD+PTSMELF+ AGSQ Sbjct: 67 FNLKQLRRSLNKITPYQLNKLLALPLDVPTSMELFQWAGSQ 107 >XP_018626231.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626232.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626233.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626234.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626235.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626236.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_009600516.2 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626237.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626238.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] XP_018626239.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like isoform X1 [Nicotiana tomentosiformis] Length = 727 Score = 99.8 bits (247), Expect = 3e-22 Identities = 56/101 (55%), Positives = 67/101 (66%), Gaps = 4/101 (3%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAE----SESDTEWERLLKP 195 MLK K IH+ + +K PSF C + C +A+ SES+ EWERLLKP Sbjct: 11 MLKRSKLLIHIREELGTLYKNPSFAFCTCMT----DDKCGNAKGSGGSESENEWERLLKP 66 Query: 196 FDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 F+LKQL+RSLN ITP QL KLL LPLD+PTSMELF+ AGSQ Sbjct: 67 FNLKQLRRSLNKITPYQLNKLLALPLDVPTSMELFQWAGSQ 107 >XP_016502873.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502874.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502875.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502876.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502877.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502878.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] XP_016502879.1 PREDICTED: pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Nicotiana tabacum] Length = 727 Score = 99.8 bits (247), Expect = 3e-22 Identities = 56/101 (55%), Positives = 67/101 (66%), Gaps = 4/101 (3%) Frame = +1 Query: 28 MLKTLKSSIHVSRIILVCFKIPSFPLCISTAPLGKNPNCNDAE----SESDTEWERLLKP 195 MLK K IH+ + +K PSF C + C +A+ SES+ EWERLLKP Sbjct: 11 MLKRSKLLIHIREELGTLYKNPSFAFCTCMT----DDKCGNAKGSGGSESENEWERLLKP 66 Query: 196 FDLKQLQRSLNPITPSQLCKLLQLPLDIPTSMELFEKAGSQ 318 F+LKQL+RSLN ITP QL KLL LPLD+PTSMELF+ AGSQ Sbjct: 67 FNLKQLRRSLNKITPYQLNKLLALPLDVPTSMELFQWAGSQ 107