BLASTX nr result
ID: Glycyrrhiza36_contig00033904
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00033904 (474 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CDP09918.1 unnamed protein product [Coffea canephora] 53 6e-07 >CDP09918.1 unnamed protein product [Coffea canephora] Length = 39 Score = 53.1 bits (126), Expect = 6e-07 Identities = 27/41 (65%), Positives = 29/41 (70%) Frame = -2 Query: 254 HFLLPLVGARLLGAQQLMDCYPKSSDKKTLKRWFFIDKRVG 132 HF L G + G+ LMDC SSDKKTLKRWFFIDKRVG Sbjct: 2 HFSL---GNEISGSLCLMDCLQSSSDKKTLKRWFFIDKRVG 39