BLASTX nr result
ID: Glycyrrhiza36_contig00033575
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00033575 (497 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AAZ32886.1 putative origin recognition complex subunit 6-contain... 54 2e-06 XP_004490041.1 PREDICTED: origin of replication complex subunit ... 54 9e-06 >AAZ32886.1 putative origin recognition complex subunit 6-containing protein [Medicago sativa] Length = 107 Score = 53.9 bits (128), Expect = 2e-06 Identities = 29/54 (53%), Positives = 33/54 (61%) Frame = +1 Query: 265 FGATKERKNPKEVKTSRSISFSHSVVCISAYLLHELPNKRTPEDGGYLSDDGLE 426 FG KE+K+PKEVKT+R LL LP+KR EDGGYLSDDG E Sbjct: 9 FGVAKEKKDPKEVKTNRD-------------LLDVLPSKRKAEDGGYLSDDGAE 49 >XP_004490041.1 PREDICTED: origin of replication complex subunit 6 [Cicer arietinum] Length = 287 Score = 54.3 bits (129), Expect(2) = 9e-06 Identities = 29/54 (53%), Positives = 33/54 (61%) Frame = +1 Query: 265 FGATKERKNPKEVKTSRSISFSHSVVCISAYLLHELPNKRTPEDGGYLSDDGLE 426 FG KE+K+PKEVKT+R LL LP+KR EDGGYLSDDG E Sbjct: 189 FGVAKEKKDPKEVKTNRD-------------LLDALPSKRKAEDGGYLSDDGAE 229 Score = 22.3 bits (46), Expect(2) = 9e-06 Identities = 8/13 (61%), Positives = 9/13 (69%) Frame = +3 Query: 228 VSATMKEFCHSQF 266 VS TMK+ CH F Sbjct: 177 VSTTMKDLCHDVF 189