BLASTX nr result
ID: Glycyrrhiza36_contig00032745
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00032745 (257 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012568481.1 PREDICTED: putative tRNA pseudouridine synthase [... 130 3e-34 KHN46102.1 Putative tRNA pseudouridine synthase [Glycine soja] 125 3e-32 XP_019456938.1 PREDICTED: putative tRNA pseudouridine synthase [... 125 6e-32 XP_006575439.1 PREDICTED: putative tRNA pseudouridine synthase i... 121 5e-31 XP_006575435.1 PREDICTED: putative tRNA pseudouridine synthase i... 121 1e-30 XP_003615971.1 tRNA pseudouridine synthase [Medicago truncatula]... 120 4e-30 GAU36246.1 hypothetical protein TSUD_214430 [Trifolium subterran... 115 1e-28 KYP72956.1 Putative tRNA pseudouridine synthase [Cajanus cajan] 113 1e-27 XP_007142071.1 hypothetical protein PHAVU_008G250100g [Phaseolus... 107 1e-25 XP_014503660.1 PREDICTED: putative tRNA pseudouridine synthase [... 103 6e-24 XP_017428381.1 PREDICTED: putative tRNA pseudouridine synthase i... 98 3e-22 KOM47189.1 hypothetical protein LR48_Vigan07g089300 [Vigna angul... 98 3e-22 XP_017428380.1 PREDICTED: putative tRNA pseudouridine synthase i... 98 4e-22 XP_010650837.1 PREDICTED: putative tRNA pseudouridine synthase i... 89 1e-18 XP_010650836.1 PREDICTED: putative tRNA pseudouridine synthase i... 89 1e-18 CAN68579.1 hypothetical protein VITISV_034891 [Vitis vinifera] 88 1e-18 XP_009369541.1 PREDICTED: putative tRNA pseudouridine synthase [... 88 2e-18 XP_008384725.1 PREDICTED: putative tRNA pseudouridine synthase [... 85 2e-17 XP_010106701.1 Putative tRNA pseudouridine synthase [Morus notab... 84 3e-17 CBI15850.3 unnamed protein product, partial [Vitis vinifera] 80 7e-16 >XP_012568481.1 PREDICTED: putative tRNA pseudouridine synthase [Cicer arietinum] Length = 442 Score = 130 bits (327), Expect = 3e-34 Identities = 67/85 (78%), Positives = 69/85 (81%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEID HLSEFNDILK+FEG HPFHNYTARSRYRKHF RR S SKSG E LSAYNS Sbjct: 140 SNDEIDCHLSEFNDILKEFEGGHPFHNYTARSRYRKHFRRRPSQSKSG----ESLSAYNS 195 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 EYEDSD EE F I+EA TEN V QN Sbjct: 196 EYEDSDKEENFKIDEAHTENIVCQN 220 >KHN46102.1 Putative tRNA pseudouridine synthase [Glycine soja] Length = 478 Score = 125 bits (314), Expect = 3e-32 Identities = 60/84 (71%), Positives = 70/84 (83%) Frame = -3 Query: 252 NDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNSE 73 +DE+DYH+SEFNDIL FEG+HPFHNYTARS+YRK FP RQS SKSGTSA+EGLS Y SE Sbjct: 183 SDEVDYHISEFNDILNVFEGIHPFHNYTARSKYRKQFPNRQSSSKSGTSAREGLS-YESE 241 Query: 72 YEDSDGEEKFNINEAFTENRVFQN 1 E SDGEE + +EA+TEN V Q+ Sbjct: 242 CEYSDGEENYETDEAYTENIVCQS 265 >XP_019456938.1 PREDICTED: putative tRNA pseudouridine synthase [Lupinus angustifolius] OIW04401.1 hypothetical protein TanjilG_32593 [Lupinus angustifolius] Length = 501 Score = 125 bits (313), Expect = 6e-32 Identities = 59/85 (69%), Positives = 70/85 (82%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEFN+ILK+FEG HPFHNYTARS+YRKH RR SPSKSGT + +SAY S Sbjct: 193 SNDEIDYHISEFNNILKEFEGGHPFHNYTARSKYRKHSLRRHSPSKSGTDIGKSMSAYES 252 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 + ED+DG E F I+EAFTEN + Q+ Sbjct: 253 DCEDNDGGENFIIDEAFTENIMCQS 277 >XP_006575439.1 PREDICTED: putative tRNA pseudouridine synthase isoform X2 [Glycine max] KRH72783.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72784.1 hypothetical protein GLYMA_02G233600 [Glycine max] Length = 403 Score = 121 bits (303), Expect = 5e-31 Identities = 59/84 (70%), Positives = 68/84 (80%) Frame = -3 Query: 252 NDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNSE 73 +DE+DYH+SEFNDIL FEG+HPFHNYTARS+YRK FP RQS SKSGTSA+E LS Y SE Sbjct: 98 SDEVDYHISEFNDILNVFEGIHPFHNYTARSKYRKQFPNRQSSSKSGTSARESLS-YESE 156 Query: 72 YEDSDGEEKFNINEAFTENRVFQN 1 E SDGEE +EA+TEN V Q+ Sbjct: 157 CEYSDGEENSETDEAYTENIVCQS 180 >XP_006575435.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Glycine max] XP_006575436.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Glycine max] XP_006575438.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Glycine max] KRH72779.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72780.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72781.1 hypothetical protein GLYMA_02G233600 [Glycine max] KRH72782.1 hypothetical protein GLYMA_02G233600 [Glycine max] Length = 493 Score = 121 bits (303), Expect = 1e-30 Identities = 59/84 (70%), Positives = 68/84 (80%) Frame = -3 Query: 252 NDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNSE 73 +DE+DYH+SEFNDIL FEG+HPFHNYTARS+YRK FP RQS SKSGTSA+E LS Y SE Sbjct: 188 SDEVDYHISEFNDILNVFEGIHPFHNYTARSKYRKQFPNRQSSSKSGTSARESLS-YESE 246 Query: 72 YEDSDGEEKFNINEAFTENRVFQN 1 E SDGEE +EA+TEN V Q+ Sbjct: 247 CEYSDGEENSETDEAYTENIVCQS 270 >XP_003615971.1 tRNA pseudouridine synthase [Medicago truncatula] AES98929.1 tRNA pseudouridine synthase [Medicago truncatula] Length = 501 Score = 120 bits (300), Expect = 4e-30 Identities = 60/85 (70%), Positives = 66/85 (77%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEFNDILK+FEG HPFHNYT+RSRYR+H PRR S SK G E LSAYNS Sbjct: 200 SNDEIDYHMSEFNDILKEFEGGHPFHNYTSRSRYRRHIPRRPSHSKCG----EILSAYNS 255 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 E EDSD EE F ++EA T N QN Sbjct: 256 EQEDSDEEENFKVDEALTGNIECQN 280 >GAU36246.1 hypothetical protein TSUD_214430 [Trifolium subterraneum] Length = 497 Score = 115 bits (289), Expect = 1e-28 Identities = 58/84 (69%), Positives = 65/84 (77%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SN+EIDYHLSEFNDILK+FEG HPFHNYT+RSRYR+H PRR S K G E L AYNS Sbjct: 197 SNEEIDYHLSEFNDILKEFEGGHPFHNYTSRSRYRRHIPRRTSHLKRG----ELLPAYNS 252 Query: 75 EYEDSDGEEKFNINEAFTENRVFQ 4 E EDSD E F I++A TEN +FQ Sbjct: 253 ECEDSDEEGNFKIDKAHTENTMFQ 276 >KYP72956.1 Putative tRNA pseudouridine synthase [Cajanus cajan] Length = 461 Score = 113 bits (282), Expect = 1e-27 Identities = 56/85 (65%), Positives = 62/85 (72%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEFNDIL FEG HPFHNYTARS+YRK+FP RQS KS S E L Y S Sbjct: 140 SNDEIDYHISEFNDILNVFEGEHPFHNYTARSKYRKNFPHRQSSPKSDKSESESLLPYAS 199 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 + E SDGEE I+EA TEN Q+ Sbjct: 200 DCEYSDGEENSEIDEAITENIACQS 224 >XP_007142071.1 hypothetical protein PHAVU_008G250100g [Phaseolus vulgaris] ESW14065.1 hypothetical protein PHAVU_008G250100g [Phaseolus vulgaris] Length = 507 Score = 107 bits (268), Expect = 1e-25 Identities = 54/80 (67%), Positives = 60/80 (75%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEF+DIL FEG HPFHNYTAR++YRKHFP +Q SKS E L Y S Sbjct: 203 SNDEIDYHISEFHDILNVFEGEHPFHNYTARAKYRKHFPNKQLSSKS----VERLPPYES 258 Query: 75 EYEDSDGEEKFNINEAFTEN 16 E E SD EE F I+EAFTEN Sbjct: 259 ECEYSDEEENFEIDEAFTEN 278 >XP_014503660.1 PREDICTED: putative tRNA pseudouridine synthase [Vigna radiata var. radiata] Length = 499 Score = 103 bits (256), Expect = 6e-24 Identities = 54/85 (63%), Positives = 60/85 (70%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEF+DIL FEG HPFHNYTARS+YRKH P RQ SKS E LS S Sbjct: 199 SNDEIDYHISEFHDILNVFEGEHPFHNYTARSKYRKHSPNRQLSSKS----VERLSPNES 254 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 EYE SD EE F ++ FTEN Q+ Sbjct: 255 EYEYSDEEENFENDKEFTENMECQS 279 >XP_017428381.1 PREDICTED: putative tRNA pseudouridine synthase isoform X2 [Vigna angularis] Length = 437 Score = 98.2 bits (243), Expect = 3e-22 Identities = 52/85 (61%), Positives = 59/85 (69%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEF+DIL FEG HPFHNYTARS+YRKH P+RQ SKS E L S Sbjct: 137 SNDEIDYHISEFHDILNVFEGEHPFHNYTARSKYRKHSPKRQLSSKS----VERLPLNES 192 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 E E D EE F ++AFTEN Q+ Sbjct: 193 ECEYIDEEENFENDKAFTENMECQS 217 >KOM47189.1 hypothetical protein LR48_Vigan07g089300 [Vigna angularis] Length = 473 Score = 98.2 bits (243), Expect = 3e-22 Identities = 52/85 (61%), Positives = 59/85 (69%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEF+DIL FEG HPFHNYTARS+YRKH P+RQ SKS E L S Sbjct: 173 SNDEIDYHISEFHDILNVFEGEHPFHNYTARSKYRKHSPKRQLSSKS----VERLPLNES 228 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 E E D EE F ++AFTEN Q+ Sbjct: 229 ECEYIDEEENFENDKAFTENMECQS 253 >XP_017428380.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Vigna angularis] BAT81396.1 hypothetical protein VIGAN_03110700 [Vigna angularis var. angularis] Length = 499 Score = 98.2 bits (243), Expect = 4e-22 Identities = 52/85 (61%), Positives = 59/85 (69%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 SNDEIDYH+SEF+DIL FEG HPFHNYTARS+YRKH P+RQ SKS E L S Sbjct: 199 SNDEIDYHISEFHDILNVFEGEHPFHNYTARSKYRKHSPKRQLSSKS----VERLPLNES 254 Query: 75 EYEDSDGEEKFNINEAFTENRVFQN 1 E E D EE F ++AFTEN Q+ Sbjct: 255 ECEYIDEEENFENDKAFTENMECQS 279 >XP_010650837.1 PREDICTED: putative tRNA pseudouridine synthase isoform X2 [Vitis vinifera] Length = 516 Score = 88.6 bits (218), Expect = 1e-18 Identities = 44/76 (57%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGT--SAKEGLSAY 82 S EID+H++EFNDIL FEG HPF NYT RS+YRK FP +QSP G AK A Sbjct: 206 SASEIDHHIAEFNDILNTFEGEHPFQNYTIRSKYRKQFPAKQSPGNGGVFRRAKSSGEAS 265 Query: 81 NSEYEDSDGEEKFNIN 34 SE+E SDGEE IN Sbjct: 266 TSEFEVSDGEENSGIN 281 >XP_010650836.1 PREDICTED: putative tRNA pseudouridine synthase isoform X1 [Vitis vinifera] Length = 520 Score = 88.6 bits (218), Expect = 1e-18 Identities = 44/76 (57%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGT--SAKEGLSAY 82 S EID+H++EFNDIL FEG HPF NYT RS+YRK FP +QSP G AK A Sbjct: 206 SASEIDHHIAEFNDILNTFEGEHPFQNYTIRSKYRKQFPAKQSPGNGGVFRRAKSSGEAS 265 Query: 81 NSEYEDSDGEEKFNIN 34 SE+E SDGEE IN Sbjct: 266 TSEFEVSDGEENSGIN 281 >CAN68579.1 hypothetical protein VITISV_034891 [Vitis vinifera] Length = 602 Score = 88.2 bits (217), Expect = 1e-18 Identities = 43/76 (56%), Positives = 50/76 (65%), Gaps = 2/76 (2%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGT--SAKEGLSAY 82 S EID+H++EFNDIL FEG HPF NYT RS+YRK FP +QSP G AK A Sbjct: 206 SASEIDHHIAEFNDILNTFEGEHPFQNYTIRSKYRKQFPAKQSPGNGGVFRRAKSSGEAS 265 Query: 81 NSEYEDSDGEEKFNIN 34 SE+E SDGEE +N Sbjct: 266 TSEFEVSDGEENSGVN 281 >XP_009369541.1 PREDICTED: putative tRNA pseudouridine synthase [Pyrus x bretschneideri] Length = 531 Score = 87.8 bits (216), Expect = 2e-18 Identities = 46/83 (55%), Positives = 56/83 (67%), Gaps = 5/83 (6%) Frame = -3 Query: 249 DEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSP-----SKSGTSAKEGLSA 85 DEIDYH+S+FN ILK FEG HPFHNYT RS+YR +P +QSP S +G S +E +A Sbjct: 212 DEIDYHISDFNKILKAFEGEHPFHNYTIRSKYRSKYPAKQSPKHGKVSIAGRSTREA-TA 270 Query: 84 YNSEYEDSDGEEKFNINEAFTEN 16 SE E+SDGEE F+ A N Sbjct: 271 SESESEESDGEEYFDETYASESN 293 >XP_008384725.1 PREDICTED: putative tRNA pseudouridine synthase [Malus domestica] Length = 530 Score = 84.7 bits (208), Expect = 2e-17 Identities = 44/84 (52%), Positives = 55/84 (65%), Gaps = 6/84 (7%) Frame = -3 Query: 249 DEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSP-----SKSGTSAKEG-LS 88 DEIDYH+S+FN+I+K FEG HPFHNYT RS+YR +P +QSP S +G S +E S Sbjct: 209 DEIDYHISDFNNIIKAFEGEHPFHNYTIRSKYRSKYPAKQSPKXGKVSIAGRSTREATAS 268 Query: 87 AYNSEYEDSDGEEKFNINEAFTEN 16 SE E+S GEE F+ A N Sbjct: 269 ESESESEESGGEENFDETYASESN 292 >XP_010106701.1 Putative tRNA pseudouridine synthase [Morus notabilis] EXC11333.1 Putative tRNA pseudouridine synthase [Morus notabilis] Length = 481 Score = 84.3 bits (207), Expect = 3e-17 Identities = 40/82 (48%), Positives = 53/82 (64%), Gaps = 2/82 (2%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 + D+ID+H+S+FN+IL FEG HPFHNYT RS+YRK FP ++S ++ S S Sbjct: 207 TTDKIDFHISDFNEILNTFEGDHPFHNYTMRSKYRKQFPAKKSYKNGCALRRQRSSEEES 266 Query: 75 EYED--SDGEEKFNINEAFTEN 16 E+E SDGEE F +N T N Sbjct: 267 EFESGASDGEENFELNGLSTSN 288 >CBI15850.3 unnamed protein product, partial [Vitis vinifera] Length = 495 Score = 80.5 bits (197), Expect = 7e-16 Identities = 37/82 (45%), Positives = 53/82 (64%) Frame = -3 Query: 255 SNDEIDYHLSEFNDILKDFEGVHPFHNYTARSRYRKHFPRRQSPSKSGTSAKEGLSAYNS 76 S EID+H++EFNDIL FEG HPF NYT RS+YRK FP +QSP G + S +S Sbjct: 206 SASEIDHHIAEFNDILNTFEGEHPFQNYTIRSKYRKQFPAKQSPGNGGVFRRAKSSVISS 265 Query: 75 EYEDSDGEEKFNINEAFTENRV 10 +Y++ + + + + +F E+ V Sbjct: 266 DYDEGENQNS-SESTSFVEHPV 286