BLASTX nr result
ID: Glycyrrhiza36_contig00032612
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00032612 (448 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013457530.1 two-component response regulator-APRR2-like prote... 62 3e-08 XP_013457531.1 two-component response regulator-APRR2-like prote... 62 3e-08 >XP_013457530.1 two-component response regulator-APRR2-like protein [Medicago truncatula] KEH31561.1 two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 560 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = +3 Query: 6 HSSIEHYPVMQYFPFSFFLLVHSGNWQVTSLHILIGAQWMSYVVTCDEIVAQL 164 HSS + YPVMQYFPFSFFLL HS QVTSL+ILI + CDEI+ L Sbjct: 494 HSSFDDYPVMQYFPFSFFLLDHSSYMQVTSLYILIRT-----ISCCDEIIVLL 541 >XP_013457531.1 two-component response regulator-APRR2-like protein [Medicago truncatula] KEH31562.1 two-component response regulator-APRR2-like protein [Medicago truncatula] Length = 580 Score = 61.6 bits (148), Expect = 3e-08 Identities = 32/53 (60%), Positives = 36/53 (67%) Frame = +3 Query: 6 HSSIEHYPVMQYFPFSFFLLVHSGNWQVTSLHILIGAQWMSYVVTCDEIVAQL 164 HSS + YPVMQYFPFSFFLL HS QVTSL+ILI + CDEI+ L Sbjct: 514 HSSFDDYPVMQYFPFSFFLLDHSSYMQVTSLYILIRT-----ISCCDEIIVLL 561