BLASTX nr result
ID: Glycyrrhiza36_contig00031939
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00031939 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU25124.1 hypothetical protein TSUD_362940 [Trifolium subterran... 55 3e-08 XP_003627669.2 cytochrome P450 family protein [Medicago truncatu... 54 1e-06 XP_013444999.1 cytochrome P450 family protein [Medicago truncatu... 52 3e-06 XP_014522443.1 PREDICTED: cytochrome P450 704C1-like [Vigna radi... 52 3e-06 XP_003627663.2 cytochrome P450 family protein [Medicago truncatu... 52 3e-06 ABC59095.1 cytochrome P450 monooxygenase CYP704G7 [Medicago trun... 52 3e-06 XP_007134455.1 hypothetical protein PHAVU_010G048800g [Phaseolus... 52 6e-06 KRH48342.1 hypothetical protein GLYMA_07G0832002, partial [Glyci... 51 8e-06 XP_017429054.1 PREDICTED: cytochrome P450 704C1-like [Vigna angu... 51 8e-06 KHN04574.1 Cytochrome P450 704C1 [Glycine soja] 51 8e-06 XP_003528924.1 PREDICTED: cytochrome P450 704C1-like [Glycine max] 51 8e-06 >GAU25124.1 hypothetical protein TSUD_362940 [Trifolium subterraneum] Length = 108 Score = 55.5 bits (132), Expect = 3e-08 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHRD 83 EKKNVTY+TM+TLHIDGGL+IKALHRD Sbjct: 82 EKKNVTYKTMITLHIDGGLDIKALHRD 108 >XP_003627669.2 cytochrome P450 family protein [Medicago truncatula] AET02145.2 cytochrome P450 family protein [Medicago truncatula] Length = 512 Score = 53.5 bits (127), Expect = 1e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHRD 83 EK+NVTY+TM+ LHIDGGLEIKALHRD Sbjct: 486 EKRNVTYKTMINLHIDGGLEIKALHRD 512 >XP_013444999.1 cytochrome P450 family protein [Medicago truncatula] KEH19024.1 cytochrome P450 family protein [Medicago truncatula] Length = 366 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHRD 83 EKKNVTY+TM+TLHIDGGLEIKAL+R+ Sbjct: 340 EKKNVTYKTMITLHIDGGLEIKALYRN 366 >XP_014522443.1 PREDICTED: cytochrome P450 704C1-like [Vigna radiata var. radiata] Length = 501 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHR 80 EKKNVTY+TM+ LHIDGGLEIKALHR Sbjct: 476 EKKNVTYKTMINLHIDGGLEIKALHR 501 >XP_003627663.2 cytochrome P450 family protein [Medicago truncatula] AET02139.2 cytochrome P450 family protein [Medicago truncatula] Length = 513 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHRD 83 EKKNVTY+TM+TLHIDGGLEIKAL+R+ Sbjct: 487 EKKNVTYKTMITLHIDGGLEIKALYRN 513 >ABC59095.1 cytochrome P450 monooxygenase CYP704G7 [Medicago truncatula] Length = 513 Score = 52.4 bits (124), Expect = 3e-06 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHRD 83 EKKNVTY+TM+TLHIDGGLEIKAL+R+ Sbjct: 487 EKKNVTYKTMITLHIDGGLEIKALYRN 513 >XP_007134455.1 hypothetical protein PHAVU_010G048800g [Phaseolus vulgaris] ESW06449.1 hypothetical protein PHAVU_010G048800g [Phaseolus vulgaris] Length = 508 Score = 51.6 bits (122), Expect = 6e-06 Identities = 26/33 (78%), Positives = 28/33 (84%), Gaps = 2/33 (6%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHR--D*KIL 95 EKKNVTY+TM+ LHIDGGLEIKA HR D KIL Sbjct: 476 EKKNVTYKTMINLHIDGGLEIKAFHRYGDSKIL 508 >KRH48342.1 hypothetical protein GLYMA_07G0832002, partial [Glycine max] Length = 406 Score = 51.2 bits (121), Expect = 8e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHR 80 EKKNV+Y+TM+TLHIDGGLEIKA HR Sbjct: 378 EKKNVSYKTMITLHIDGGLEIKAFHR 403 >XP_017429054.1 PREDICTED: cytochrome P450 704C1-like [Vigna angularis] KOM47919.1 hypothetical protein LR48_Vigan07g162300 [Vigna angularis] BAT97785.1 hypothetical protein VIGAN_09133300 [Vigna angularis var. angularis] Length = 501 Score = 51.2 bits (121), Expect = 8e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHR 80 EK+NVTY+TM+ LHIDGGLEIKALHR Sbjct: 476 EKRNVTYKTMINLHIDGGLEIKALHR 501 >KHN04574.1 Cytochrome P450 704C1 [Glycine soja] Length = 509 Score = 51.2 bits (121), Expect = 8e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHR 80 EKKNV+Y+TM+TLHIDGGLEIKA HR Sbjct: 481 EKKNVSYKTMITLHIDGGLEIKAFHR 506 >XP_003528924.1 PREDICTED: cytochrome P450 704C1-like [Glycine max] Length = 509 Score = 51.2 bits (121), Expect = 8e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +3 Query: 3 EKKNVTYRTMLTLHIDGGLEIKALHR 80 EKKNV+Y+TM+TLHIDGGLEIKA HR Sbjct: 481 EKKNVSYKTMITLHIDGGLEIKAFHR 506