BLASTX nr result
ID: Glycyrrhiza36_contig00031863
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00031863 (376 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU45686.1 hypothetical protein TSUD_268180 [Trifolium subterran... 72 5e-14 XP_004506390.1 PREDICTED: ethylene-responsive transcription fact... 74 5e-13 XP_003605655.2 DNA-binding domain protein [Medicago truncatula] ... 67 5e-11 KHN11642.1 Dehydration-responsive element-binding protein 3 [Gly... 65 1e-10 XP_003534428.2 PREDICTED: dehydration-responsive element-binding... 65 2e-10 KRH40027.1 hypothetical protein GLYMA_09G233800 [Glycine max] 65 2e-10 XP_017432122.1 PREDICTED: dehydration-responsive element-binding... 62 3e-09 XP_014521333.1 PREDICTED: dehydration-responsive element-binding... 62 3e-09 >GAU45686.1 hypothetical protein TSUD_268180 [Trifolium subterraneum] Length = 82 Score = 71.6 bits (174), Expect = 5e-14 Identities = 36/53 (67%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -2 Query: 372 EYWDRFGEESLSTTPFQDAKDAPLMSPIRVGSTFGD-LAWNEVFNFNDDILAI 217 E+W EE +TT F D KDAPLMSP RVG TFGD + WNEVFNFNDDILA+ Sbjct: 30 EWWKE--EEYATTTSFWDVKDAPLMSPTRVGPTFGDMMTWNEVFNFNDDILAM 80 >XP_004506390.1 PREDICTED: ethylene-responsive transcription factor ERF043-like [Cicer arietinum] Length = 306 Score = 73.6 bits (179), Expect = 5e-13 Identities = 36/53 (67%), Positives = 40/53 (75%) Frame = -2 Query: 372 EYWDRFGEESLSTTPFQDAKDAPLMSPIRVGSTFGDLAWNEVFNFNDDILAIA 214 E+W + EE +ST F D KD PLMSP R+GSTFGDL WNEVFNFNDDIL A Sbjct: 254 EWWKQ--EECVSTMSFWDVKDDPLMSPPRMGSTFGDLTWNEVFNFNDDILTKA 304 >XP_003605655.2 DNA-binding domain protein [Medicago truncatula] AES87852.2 DNA-binding domain protein [Medicago truncatula] Length = 222 Score = 67.0 bits (162), Expect = 5e-11 Identities = 33/49 (67%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -2 Query: 372 EYWDRFGEESLSTTPFQDAKDAPLMSPIRVGSTFGD-LAWNEVFNFNDD 229 E+W EE +STT F D +DAPLMSP RVGS FGD + WNEVFNFNDD Sbjct: 169 EWWKE--EECVSTTSFWDVEDAPLMSPTRVGSIFGDMMTWNEVFNFNDD 215 >KHN11642.1 Dehydration-responsive element-binding protein 3 [Glycine soja] Length = 164 Score = 65.1 bits (157), Expect = 1e-10 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -2 Query: 345 SLSTTPFQDAKDAPLMSPIRVGSTFGDLAWNEVFNFNDDILAIASTA 205 S +T+ F D +APLMSP+RV STFGD +W+++F+FNDDIL + ST+ Sbjct: 113 STTTSSFHDVMEAPLMSPLRVDSTFGDFSWDQLFDFNDDILIVGSTS 159 >XP_003534428.2 PREDICTED: dehydration-responsive element-binding protein 3 [Glycine max] Length = 190 Score = 65.1 bits (157), Expect = 2e-10 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -2 Query: 345 SLSTTPFQDAKDAPLMSPIRVGSTFGDLAWNEVFNFNDDILAIASTA 205 S +T+ F D +APLMSP+RV STFGD +W+++F+FNDDIL + ST+ Sbjct: 139 STTTSSFHDVMEAPLMSPLRVDSTFGDFSWDQLFDFNDDILIVGSTS 185 >KRH40027.1 hypothetical protein GLYMA_09G233800 [Glycine max] Length = 201 Score = 65.1 bits (157), Expect = 2e-10 Identities = 27/47 (57%), Positives = 38/47 (80%) Frame = -2 Query: 345 SLSTTPFQDAKDAPLMSPIRVGSTFGDLAWNEVFNFNDDILAIASTA 205 S +T+ F D +APLMSP+RV STFGD +W+++F+FNDDIL + ST+ Sbjct: 150 STTTSSFHDVMEAPLMSPLRVDSTFGDFSWDQLFDFNDDILIVGSTS 196 >XP_017432122.1 PREDICTED: dehydration-responsive element-binding protein 3-like [Vigna angularis] KOM51311.1 hypothetical protein LR48_Vigan08g213800 [Vigna angularis] BAT91365.1 hypothetical protein VIGAN_06268700 [Vigna angularis var. angularis] Length = 175 Score = 61.6 bits (148), Expect = 3e-09 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = -2 Query: 363 DRFGEES-LSTTPFQDAKDAPLMSPIRVGSTFGDLAWNEVFNFNDD 229 D G+ES +ST F+D KDAPLMSP+RV TFGD +WN +F+FN D Sbjct: 125 DNLGDESRISTMSFEDVKDAPLMSPLRVDLTFGDFSWNNLFHFNYD 170 >XP_014521333.1 PREDICTED: dehydration-responsive element-binding protein 3-like [Vigna radiata var. radiata] Length = 177 Score = 61.6 bits (148), Expect = 3e-09 Identities = 29/49 (59%), Positives = 38/49 (77%), Gaps = 2/49 (4%) Frame = -2 Query: 363 DRFGEES-LSTTPFQDAKDAPLMSPIRVGSTFGDLAWNEVFNFN-DDIL 223 + G+ES +ST F+D KDAPLMSP+RV TFGD +WN +F+FN DD+L Sbjct: 127 ENLGDESRISTMSFEDVKDAPLMSPLRVDLTFGDFSWNNLFHFNYDDVL 175