BLASTX nr result
ID: Glycyrrhiza36_contig00031528
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00031528 (326 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OIW08153.1 hypothetical protein TanjilG_06696 [Lupinus angustifo... 67 7e-11 KYP51615.1 putative LRR receptor-like serine/threonine-protein k... 55 2e-06 XP_019449361.1 PREDICTED: probable inactive leucine-rich repeat ... 54 4e-06 XP_019449360.1 PREDICTED: probable inactive leucine-rich repeat ... 54 4e-06 >OIW08153.1 hypothetical protein TanjilG_06696 [Lupinus angustifolius] Length = 1086 Score = 67.4 bits (163), Expect = 7e-11 Identities = 36/58 (62%), Positives = 44/58 (75%) Frame = -3 Query: 198 LSFSPLEEKMAKPVSHSQXXXXXXXMVFLSIHLSEELQFSQYQTLLKVQKLLGYPSAL 25 +SF PLEEKMAK V HSQ +FL+IH+SE+L+FSQ +TL+KVQ LLGYPS L Sbjct: 270 VSFIPLEEKMAKLVFHSQLLLLI---LFLAIHVSEQLEFSQSETLVKVQNLLGYPSVL 324 >KYP51615.1 putative LRR receptor-like serine/threonine-protein kinase At1g14390 family [Cajanus cajan] Length = 800 Score = 54.7 bits (130), Expect = 2e-06 Identities = 31/48 (64%), Positives = 35/48 (72%) Frame = -3 Query: 165 KPVSHSQXXXXXXXMVFLSIHLSEELQFSQYQTLLKVQKLLGYPSALG 22 KPVS S +FL I LSE+L+FSQ QTLLKVQ+LLGYPSALG Sbjct: 4 KPVSLSHLLLLV---LFLGIQLSEQLEFSQSQTLLKVQQLLGYPSALG 48 >XP_019449361.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 isoform X2 [Lupinus angustifolius] Length = 723 Score = 53.9 bits (128), Expect = 4e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -3 Query: 171 MAKPVSHSQXXXXXXXMVFLSIHLSEELQFSQYQTLLKVQKLLGYPSAL 25 MAK V HSQ +FL+IH+SE+L+FSQ +TL+KVQ LLGYPS L Sbjct: 1 MAKLVFHSQLLLLI---LFLAIHVSEQLEFSQSETLVKVQNLLGYPSVL 46 >XP_019449360.1 PREDICTED: probable inactive leucine-rich repeat receptor-like protein kinase At3g03770 isoform X1 [Lupinus angustifolius] Length = 858 Score = 53.9 bits (128), Expect = 4e-06 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -3 Query: 171 MAKPVSHSQXXXXXXXMVFLSIHLSEELQFSQYQTLLKVQKLLGYPSAL 25 MAK V HSQ +FL+IH+SE+L+FSQ +TL+KVQ LLGYPS L Sbjct: 1 MAKLVFHSQLLLLI---LFLAIHVSEQLEFSQSETLVKVQNLLGYPSVL 46