BLASTX nr result
ID: Glycyrrhiza36_contig00030408
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00030408 (211 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004509237.1 PREDICTED: elongation of fatty acids protein 3-li... 75 1e-14 XP_007156013.1 hypothetical protein PHAVU_003G251300g [Phaseolus... 71 5e-13 XP_008339387.1 PREDICTED: elongation of fatty acids protein 3-li... 70 1e-12 XP_010531189.1 PREDICTED: elongation of fatty acids protein 3-li... 70 2e-12 XP_012852600.1 PREDICTED: elongation of fatty acids protein 3-li... 69 4e-12 EYU44307.1 hypothetical protein MIMGU_mgv1a010872mg [Erythranthe... 69 4e-12 XP_003629499.1 GNS1/SUR4 membrane family protein [Medicago trunc... 69 4e-12 XP_008241619.1 PREDICTED: LOW QUALITY PROTEIN: elongation of fat... 68 5e-12 XP_007202280.1 hypothetical protein PRUPE_ppa008998mg [Prunus pe... 68 6e-12 XP_016206678.1 PREDICTED: elongation of fatty acids protein 3-li... 68 7e-12 XP_014507646.1 PREDICTED: elongation of fatty acids protein 3-li... 68 7e-12 XP_017424151.1 PREDICTED: elongation of fatty acids protein 3-li... 68 7e-12 XP_004300594.2 PREDICTED: elongation of fatty acids protein 3-li... 68 8e-12 KRH08321.1 hypothetical protein GLYMA_16G142200 [Glycine max] 67 1e-11 XP_019446776.1 PREDICTED: elongation of fatty acids protein 3-li... 67 1e-11 XP_011099280.1 PREDICTED: elongation of fatty acids protein 3-li... 67 1e-11 XP_008361373.1 PREDICTED: elongation of fatty acids protein 3-li... 67 2e-11 XP_004141955.1 PREDICTED: elongation of fatty acids protein 3-li... 67 2e-11 XP_003518054.1 PREDICTED: elongation of fatty acids protein 3-li... 67 2e-11 XP_009379178.1 PREDICTED: elongation of fatty acids protein 3-li... 67 2e-11 >XP_004509237.1 PREDICTED: elongation of fatty acids protein 3-like [Cicer arietinum] Length = 308 Score = 75.5 bits (184), Expect = 1e-14 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = +3 Query: 102 ATAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 ATAI LIYYLSEHPSIV FRWSHAHSWGSTWSFLF Sbjct: 6 ATAIRTLIYYLSEHPSIVEFRWSHAHSWGSTWSFLF 41 >XP_007156013.1 hypothetical protein PHAVU_003G251300g [Phaseolus vulgaris] ESW28007.1 hypothetical protein PHAVU_003G251300g [Phaseolus vulgaris] Length = 330 Score = 71.2 bits (173), Expect = 5e-13 Identities = 38/61 (62%), Positives = 40/61 (65%) Frame = +3 Query: 27 KTE*RNVNPTTAIHGVAFGITMGKAATAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFL 206 +TE RNV P TM KA LIYYLSEHPSIVGFRWSHA SWG+TWSFL Sbjct: 28 RTEPRNVKPR---------FTMPKAPPP---LIYYLSEHPSIVGFRWSHAQSWGATWSFL 75 Query: 207 F 209 F Sbjct: 76 F 76 >XP_008339387.1 PREDICTED: elongation of fatty acids protein 3-like [Malus domestica] Length = 517 Score = 70.5 bits (171), Expect = 1e-12 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +3 Query: 81 GITMGKAATAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 G T AI AL ++LSEHPSIVGFRWSH HSWGSTWSFLF Sbjct: 209 GKTKXLGQPAIQALTFWLSEHPSIVGFRWSHTHSWGSTWSFLF 251 >XP_010531189.1 PREDICTED: elongation of fatty acids protein 3-like [Tarenaya hassleriana] Length = 392 Score = 69.7 bits (169), Expect = 2e-12 Identities = 32/53 (60%), Positives = 37/53 (69%) Frame = +3 Query: 51 PTTAIHGVAFGITMGKAATAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 P+ A H I +TA+ AL YYLSEHP IVGFRWSHA S+G+TWSFLF Sbjct: 87 PSRATHHRRINIHRSTMSTALSALTYYLSEHPYIVGFRWSHAQSFGATWSFLF 139 >XP_012852600.1 PREDICTED: elongation of fatty acids protein 3-like [Erythranthe guttata] Length = 296 Score = 68.6 bits (166), Expect = 4e-12 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 105 TAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 T ++L YYLSEHPSIVGFRWSHA SWGSTWSFLF Sbjct: 2 TPFNSLRYYLSEHPSIVGFRWSHAQSWGSTWSFLF 36 >EYU44307.1 hypothetical protein MIMGU_mgv1a010872mg [Erythranthe guttata] Length = 299 Score = 68.6 bits (166), Expect = 4e-12 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +3 Query: 105 TAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 T ++L YYLSEHPSIVGFRWSHA SWGSTWSFLF Sbjct: 2 TPFNSLRYYLSEHPSIVGFRWSHAQSWGSTWSFLF 36 >XP_003629499.1 GNS1/SUR4 membrane family protein [Medicago truncatula] AET03975.1 GNS1/SUR4 membrane family protein [Medicago truncatula] Length = 313 Score = 68.6 bits (166), Expect = 4e-12 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +3 Query: 105 TAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFL 206 T I LIYYLSEHPSI+ FRWSH+HSWGSTWSFL Sbjct: 11 TTIGTLIYYLSEHPSIISFRWSHSHSWGSTWSFL 44 >XP_008241619.1 PREDICTED: LOW QUALITY PROTEIN: elongation of fatty acids protein 3-like [Prunus mume] Length = 295 Score = 68.2 bits (165), Expect = 5e-12 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 111 IHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 I L ++LSEHPSIVGFRWSHAHSWGSTWSFLF Sbjct: 7 IQTLTFWLSEHPSIVGFRWSHAHSWGSTWSFLF 39 >XP_007202280.1 hypothetical protein PRUPE_ppa008998mg [Prunus persica] ONH96729.1 hypothetical protein PRUPE_7G148200 [Prunus persica] Length = 311 Score = 68.2 bits (165), Expect = 6e-12 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 111 IHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 I L ++LSEHPSIVGFRWSHAHSWGSTWSFLF Sbjct: 7 IQTLTFWLSEHPSIVGFRWSHAHSWGSTWSFLF 39 >XP_016206678.1 PREDICTED: elongation of fatty acids protein 3-like [Arachis ipaensis] Length = 286 Score = 67.8 bits (164), Expect = 7e-12 Identities = 30/35 (85%), Positives = 32/35 (91%), Gaps = 1/35 (2%) Frame = +3 Query: 108 AIHALI-YYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 +IHALI +YLSEHPSIVGFRWSH SWGSTWSFLF Sbjct: 12 SIHALITFYLSEHPSIVGFRWSHTQSWGSTWSFLF 46 >XP_014507646.1 PREDICTED: elongation of fatty acids protein 3-like [Vigna radiata var. radiata] Length = 290 Score = 67.8 bits (164), Expect = 7e-12 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 120 LIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 LIYYLSEHPSIVGFRWSHA SWG+TWSFLF Sbjct: 8 LIYYLSEHPSIVGFRWSHAQSWGATWSFLF 37 >XP_017424151.1 PREDICTED: elongation of fatty acids protein 3-like [Vigna angularis] KOM32324.1 hypothetical protein LR48_Vigan01g188000 [Vigna angularis] BAT75501.1 hypothetical protein VIGAN_01337300 [Vigna angularis var. angularis] Length = 290 Score = 67.8 bits (164), Expect = 7e-12 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = +3 Query: 120 LIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 LIYYLSEHPSIVGFRWSHA SWG+TWSFLF Sbjct: 8 LIYYLSEHPSIVGFRWSHAQSWGATWSFLF 37 >XP_004300594.2 PREDICTED: elongation of fatty acids protein 3-like [Fragaria vesca subsp. vesca] Length = 393 Score = 68.2 bits (165), Expect = 8e-12 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = +3 Query: 111 IHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 I L ++LSEHPSIVGFRWSHAHSWGSTWSFLF Sbjct: 101 IQTLTFWLSEHPSIVGFRWSHAHSWGSTWSFLF 133 >KRH08321.1 hypothetical protein GLYMA_16G142200 [Glycine max] Length = 291 Score = 67.4 bits (163), Expect = 1e-11 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = +3 Query: 108 AIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 A A+IYYLSEHP+IVGFRWSHA SWG+TWSFLF Sbjct: 6 APRAVIYYLSEHPAIVGFRWSHAQSWGATWSFLF 39 >XP_019446776.1 PREDICTED: elongation of fatty acids protein 3-like [Lupinus angustifolius] OIW09729.1 hypothetical protein TanjilG_09402 [Lupinus angustifolius] Length = 294 Score = 67.4 bits (163), Expect = 1e-11 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +3 Query: 111 IHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 IH +I+YLSEHP+IVGFRW+H SWGSTWSFLF Sbjct: 9 IHTIIFYLSEHPAIVGFRWNHVQSWGSTWSFLF 41 >XP_011099280.1 PREDICTED: elongation of fatty acids protein 3-like [Sesamum indicum] Length = 300 Score = 67.0 bits (162), Expect = 1e-11 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 105 TAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 T+ H+L YYLSE PSIVGFRWSH SWGSTWSFLF Sbjct: 2 TSYHSLRYYLSEQPSIVGFRWSHTQSWGSTWSFLF 36 >XP_008361373.1 PREDICTED: elongation of fatty acids protein 3-like [Malus domestica] Length = 302 Score = 67.0 bits (162), Expect = 2e-11 Identities = 27/33 (81%), Positives = 30/33 (90%) Frame = +3 Query: 111 IHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 I AL ++LSEHP+IVGFRWSH HSWGSTWSFLF Sbjct: 4 IQALTFWLSEHPTIVGFRWSHTHSWGSTWSFLF 36 >XP_004141955.1 PREDICTED: elongation of fatty acids protein 3-like [Cucumis sativus] KGN48446.1 hypothetical protein Csa_6G487670 [Cucumis sativus] Length = 316 Score = 67.0 bits (162), Expect = 2e-11 Identities = 28/40 (70%), Positives = 30/40 (75%) Frame = +3 Query: 90 MGKAATAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 M I+ Y+LSEHPSIVGFRWSH HSWGSTWSFLF Sbjct: 1 MSSGIIPINDFTYWLSEHPSIVGFRWSHTHSWGSTWSFLF 40 >XP_003518054.1 PREDICTED: elongation of fatty acids protein 3-like [Glycine max] KRH69956.1 hypothetical protein GLYMA_02G059300 [Glycine max] Length = 282 Score = 66.6 bits (161), Expect = 2e-11 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +3 Query: 120 LIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 LIYYLSEHP+IVGFRWSHA SWG+TWSFLF Sbjct: 3 LIYYLSEHPAIVGFRWSHAQSWGATWSFLF 32 >XP_009379178.1 PREDICTED: elongation of fatty acids protein 3-like [Pyrus x bretschneideri] Length = 305 Score = 66.6 bits (161), Expect = 2e-11 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = +3 Query: 99 AATAIHALIYYLSEHPSIVGFRWSHAHSWGSTWSFLF 209 A AI AL ++LSE PSIVGFRWSH HSWGSTWSFLF Sbjct: 3 AQPAIQALTFWLSEPPSIVGFRWSHTHSWGSTWSFLF 39