BLASTX nr result
ID: Glycyrrhiza36_contig00030333
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00030333 (226 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU32208.1 hypothetical protein TSUD_277880 [Trifolium subterran... 52 3e-06 >GAU32208.1 hypothetical protein TSUD_277880 [Trifolium subterraneum] Length = 166 Score = 51.6 bits (122), Expect = 3e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = +3 Query: 96 YQPLLQSRSVSHSGTTRSDFEFPTTGSFGATLPNDVVFCGKVI 224 YQ LLQ+ SVS+ GTT+SDFEF F TL DVVFCGK+I Sbjct: 4 YQKLLQAGSVSNRGTTQSDFEF--NSGFMNTLSTDVVFCGKII 44