BLASTX nr result
ID: Glycyrrhiza36_contig00030308
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00030308 (237 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012574047.1 PREDICTED: growth-regulating factor 5-like isofor... 59 2e-08 XP_004510465.1 PREDICTED: growth-regulating factor 5-like isofor... 59 2e-08 GAU32108.1 hypothetical protein TSUD_358150 [Trifolium subterran... 58 2e-08 XP_007135443.1 hypothetical protein PHAVU_010G130000g [Phaseolus... 59 3e-08 KYP63697.1 hypothetical protein KK1_018276 [Cajanus cajan] 59 3e-08 XP_003529835.1 PREDICTED: growth-regulating factor 5-like [Glyci... 57 7e-08 KHN01405.1 hypothetical protein glysoja_009611 [Glycine soja] 57 7e-08 XP_018835002.1 PREDICTED: growth-regulating factor 5-like isofor... 57 9e-08 XP_018835001.1 PREDICTED: growth-regulating factor 5-like isofor... 57 1e-07 XP_018835000.1 PREDICTED: growth-regulating factor 5-like isofor... 57 1e-07 XP_003627270.2 growth-regulating factor-like protein [Medicago t... 55 4e-07 XP_007024621.2 PREDICTED: growth-regulating factor 5 [Theobroma ... 55 5e-07 EOY27243.1 Growth-regulating factor 5, putative [Theobroma cacao] 55 5e-07 OMO70647.1 Growth-regulating factor 8 [Corchorus capsularis] 55 5e-07 XP_017405895.1 PREDICTED: growth-regulating factor 5-like isofor... 55 7e-07 XP_014515268.1 PREDICTED: growth-regulating factor 5 [Vigna radi... 55 7e-07 XP_017405893.1 PREDICTED: growth-regulating factor 5-like isofor... 55 7e-07 BAT98305.1 hypothetical protein VIGAN_09195100 [Vigna angularis ... 55 7e-07 KHN39631.1 hypothetical protein glysoja_020709 [Glycine soja] 54 9e-07 XP_018860728.1 PREDICTED: growth-regulating factor 5-like isofor... 54 1e-06 >XP_012574047.1 PREDICTED: growth-regulating factor 5-like isoform X2 [Cicer arietinum] Length = 355 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS S+RNRSPFTP QWQELEQQALVFKY++ Sbjct: 1 MMSASSRNRSPFTPNQWQELEQQALVFKYMV 31 >XP_004510465.1 PREDICTED: growth-regulating factor 5-like isoform X1 [Cicer arietinum] XP_012574046.1 PREDICTED: growth-regulating factor 5-like isoform X1 [Cicer arietinum] Length = 356 Score = 59.3 bits (142), Expect = 2e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS S+RNRSPFTP QWQELEQQALVFKY++ Sbjct: 1 MMSASSRNRSPFTPNQWQELEQQALVFKYMV 31 >GAU32108.1 hypothetical protein TSUD_358150 [Trifolium subterraneum] Length = 232 Score = 58.2 bits (139), Expect = 2e-08 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 M+S S+RNRSPFTP QWQELEQQALVFKY++ Sbjct: 1 MLSASSRNRSPFTPNQWQELEQQALVFKYMV 31 >XP_007135443.1 hypothetical protein PHAVU_010G130000g [Phaseolus vulgaris] ESW07437.1 hypothetical protein PHAVU_010G130000g [Phaseolus vulgaris] Length = 339 Score = 58.5 bits (140), Expect = 3e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 101 SESARNRSPFTPTQWQELEQQALVFKYII 15 S SARNRSPFTPTQWQELEQQALVFKY++ Sbjct: 5 SASARNRSPFTPTQWQELEQQALVFKYMV 33 >KYP63697.1 hypothetical protein KK1_018276 [Cajanus cajan] Length = 382 Score = 58.5 bits (140), Expect = 3e-08 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -2 Query: 101 SESARNRSPFTPTQWQELEQQALVFKYII 15 S SARNRSPFTPTQWQELEQQALVFKY++ Sbjct: 5 SASARNRSPFTPTQWQELEQQALVFKYMV 33 >XP_003529835.1 PREDICTED: growth-regulating factor 5-like [Glycine max] XP_014633187.1 PREDICTED: growth-regulating factor 5-like [Glycine max] KRH47599.1 hypothetical protein GLYMA_07G038400 [Glycine max] Length = 345 Score = 57.4 bits (137), Expect = 7e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS SARNRSPFT TQWQELE QALVFKY++ Sbjct: 1 MMSASARNRSPFTQTQWQELEHQALVFKYMV 31 >KHN01405.1 hypothetical protein glysoja_009611 [Glycine soja] Length = 359 Score = 57.4 bits (137), Expect = 7e-08 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS SARNRSPFT TQWQELE QALVFKY++ Sbjct: 1 MMSASARNRSPFTQTQWQELEHQALVFKYMV 31 >XP_018835002.1 PREDICTED: growth-regulating factor 5-like isoform X3 [Juglans regia] Length = 309 Score = 57.0 bits (136), Expect = 9e-08 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS SARNRSPFT TQWQELE QAL+FKY++ Sbjct: 1 MMSASARNRSPFTSTQWQELEHQALIFKYMV 31 >XP_018835001.1 PREDICTED: growth-regulating factor 5-like isoform X2 [Juglans regia] Length = 329 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS SARNRSPFT TQWQELE QAL+FKY++ Sbjct: 1 MMSASARNRSPFTSTQWQELEHQALIFKYMV 31 >XP_018835000.1 PREDICTED: growth-regulating factor 5-like isoform X1 [Juglans regia] Length = 335 Score = 57.0 bits (136), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS SARNRSPFT TQWQELE QAL+FKY++ Sbjct: 1 MMSASARNRSPFTSTQWQELEHQALIFKYMV 31 >XP_003627270.2 growth-regulating factor-like protein [Medicago truncatula] AET01746.2 growth-regulating factor-like protein [Medicago truncatula] Length = 348 Score = 55.5 bits (132), Expect = 4e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MMS S+RNRS FTP QWQELEQQALVFKY++ Sbjct: 1 MMSASSRNRSLFTPNQWQELEQQALVFKYMV 31 >XP_007024621.2 PREDICTED: growth-regulating factor 5 [Theobroma cacao] Length = 357 Score = 55.1 bits (131), Expect = 5e-07 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -2 Query: 95 SARNRSPFTPTQWQELEQQALVFKYII 15 SARNRSPFTPTQWQELE QAL+FKY++ Sbjct: 3 SARNRSPFTPTQWQELEHQALIFKYMV 29 >EOY27243.1 Growth-regulating factor 5, putative [Theobroma cacao] Length = 357 Score = 55.1 bits (131), Expect = 5e-07 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = -2 Query: 95 SARNRSPFTPTQWQELEQQALVFKYII 15 SARNRSPFTPTQWQELE QAL+FKY++ Sbjct: 3 SARNRSPFTPTQWQELEHQALIFKYMV 29 >OMO70647.1 Growth-regulating factor 8 [Corchorus capsularis] Length = 365 Score = 55.1 bits (131), Expect = 5e-07 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 M++ +ARNRSPFTPTQWQELE QAL++KY++ Sbjct: 1 MITTAARNRSPFTPTQWQELEHQALIYKYMV 31 >XP_017405895.1 PREDICTED: growth-regulating factor 5-like isoform X3 [Vigna angularis] Length = 339 Score = 54.7 bits (130), Expect = 7e-07 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = -2 Query: 95 SARNRSPFTPTQWQELEQQALVFKYII 15 +ARNRSPFTP+QWQELEQQALVFKY++ Sbjct: 7 TARNRSPFTPSQWQELEQQALVFKYMV 33 >XP_014515268.1 PREDICTED: growth-regulating factor 5 [Vigna radiata var. radiata] Length = 339 Score = 54.7 bits (130), Expect = 7e-07 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = -2 Query: 95 SARNRSPFTPTQWQELEQQALVFKYII 15 +ARNRSPFTP+QWQELEQQALVFKY++ Sbjct: 7 TARNRSPFTPSQWQELEQQALVFKYMV 33 >XP_017405893.1 PREDICTED: growth-regulating factor 5-like isoform X1 [Vigna angularis] XP_017405894.1 PREDICTED: growth-regulating factor 5-like isoform X2 [Vigna angularis] Length = 344 Score = 54.7 bits (130), Expect = 7e-07 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = -2 Query: 95 SARNRSPFTPTQWQELEQQALVFKYII 15 +ARNRSPFTP+QWQELEQQALVFKY++ Sbjct: 7 TARNRSPFTPSQWQELEQQALVFKYMV 33 >BAT98305.1 hypothetical protein VIGAN_09195100 [Vigna angularis var. angularis] Length = 353 Score = 54.7 bits (130), Expect = 7e-07 Identities = 23/27 (85%), Positives = 27/27 (100%) Frame = -2 Query: 95 SARNRSPFTPTQWQELEQQALVFKYII 15 +ARNRSPFTP+QWQELEQQALVFKY++ Sbjct: 7 TARNRSPFTPSQWQELEQQALVFKYMV 33 >KHN39631.1 hypothetical protein glysoja_020709 [Glycine soja] Length = 373 Score = 54.3 bits (129), Expect = 9e-07 Identities = 27/33 (81%), Positives = 29/33 (87%), Gaps = 2/33 (6%) Frame = -2 Query: 107 MMSESA--RNRSPFTPTQWQELEQQALVFKYII 15 MMS SA RNRSPFT TQWQELEQQALVFKY++ Sbjct: 1 MMSASAGARNRSPFTQTQWQELEQQALVFKYMV 33 >XP_018860728.1 PREDICTED: growth-regulating factor 5-like isoform X2 [Juglans regia] Length = 336 Score = 53.9 bits (128), Expect = 1e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -2 Query: 107 MMSESARNRSPFTPTQWQELEQQALVFKYII 15 MM+ +ARNRSPFT TQWQELE QAL+FKY++ Sbjct: 1 MMNANARNRSPFTATQWQELELQALIFKYMV 31