BLASTX nr result
ID: Glycyrrhiza36_contig00030248
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00030248 (264 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004509890.1 PREDICTED: metalloendoproteinase 1-like [Cicer ar... 55 5e-07 >XP_004509890.1 PREDICTED: metalloendoproteinase 1-like [Cicer arietinum] Length = 377 Score = 55.5 bits (132), Expect = 5e-07 Identities = 29/44 (65%), Positives = 32/44 (72%) Frame = -1 Query: 132 MNKHHQLQHLIFAFAISFSLTAAFVSARLFPNVPSSWIPANATP 1 MNK QL +LIF F ISFSLT VSARLFP+VP SWIP+ P Sbjct: 1 MNKQFQLLNLIFTFIISFSLTFIVVSARLFPDVP-SWIPSGTPP 43