BLASTX nr result
ID: Glycyrrhiza36_contig00029928
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00029928 (155 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP74705.1 Pentatricopeptide repeat-containing protein At4g13650... 51 5e-06 OIV91374.1 hypothetical protein TanjilG_01992 [Lupinus angustifo... 51 5e-06 XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-cont... 51 5e-06 >KYP74705.1 Pentatricopeptide repeat-containing protein At4g13650 family [Cajanus cajan] Length = 815 Score = 50.8 bits (120), Expect = 5e-06 Identities = 22/37 (59%), Positives = 29/37 (78%) Frame = -3 Query: 153 NFSAKCGFPTFARQMLVQMPEQHVPSWTALSQGFGAQ 43 NF AKCG+P++ R++L ++PEQ V SWTAL QG AQ Sbjct: 45 NFYAKCGYPSYGRRVLDEVPEQDVVSWTALIQGLVAQ 81 >OIV91374.1 hypothetical protein TanjilG_01992 [Lupinus angustifolius] Length = 856 Score = 50.8 bits (120), Expect = 5e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 153 NFSAKCGFPTFARQMLVQMPEQHVPSWTALSQGFGAQ 43 NF AKCG ++ARQ+L +MPEQ V SWTAL QGF Q Sbjct: 24 NFYAKCGCHSYARQVLDEMPEQDVVSWTALIQGFVGQ 60 >XP_019427492.1 PREDICTED: putative pentatricopeptide repeat-containing protein At3g23330 [Lupinus angustifolius] Length = 978 Score = 50.8 bits (120), Expect = 5e-06 Identities = 24/37 (64%), Positives = 28/37 (75%) Frame = -3 Query: 153 NFSAKCGFPTFARQMLVQMPEQHVPSWTALSQGFGAQ 43 NF AKCG ++ARQ+L +MPEQ V SWTAL QGF Q Sbjct: 146 NFYAKCGCHSYARQVLDEMPEQDVVSWTALIQGFVGQ 182