BLASTX nr result
ID: Glycyrrhiza36_contig00029921
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00029921 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN41721.1 Pentatricopeptide repeat-containing protein, mitochon... 79 8e-15 XP_014628080.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 3e-12 KRG90497.1 hypothetical protein GLYMA_20G094700 [Glycine max] 71 3e-12 XP_004511762.1 PREDICTED: pentatricopeptide repeat-containing pr... 56 8e-07 >KHN41721.1 Pentatricopeptide repeat-containing protein, mitochondrial [Glycine soja] Length = 737 Score = 78.6 bits (192), Expect = 8e-15 Identities = 34/55 (61%), Positives = 42/55 (76%) Frame = +2 Query: 77 HRSNHSQPSKPPLPFTRKSECDESLHLHYLMKGWHHEA*ELLQSFFGGDRHARVV 241 +R NHS+P KPP PF +++ECDESL LHYL GWH +A LLQ+ GGD H+RVV Sbjct: 32 YRVNHSRPRKPPFPFPKRTECDESLLLHYLSNGWHDDARNLLQNSSGGDLHSRVV 86 >XP_014628080.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628081.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628082.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628083.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628084.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628085.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628086.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628087.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628088.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628089.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628090.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628091.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628092.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628093.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628094.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] XP_014628095.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial-like [Glycine max] Length = 766 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +2 Query: 77 HRSNHSQPSKPPLPFTRKSECDESLHLHYLMKGWHHEA*ELLQSFFGGDRHARVV 241 +R NHS+P K P PF +++ECDESL LHYL GW ++A LLQ+ GGD H RVV Sbjct: 61 YRINHSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDLHLRVV 115 >KRG90497.1 hypothetical protein GLYMA_20G094700 [Glycine max] Length = 894 Score = 71.2 bits (173), Expect = 3e-12 Identities = 32/55 (58%), Positives = 40/55 (72%) Frame = +2 Query: 77 HRSNHSQPSKPPLPFTRKSECDESLHLHYLMKGWHHEA*ELLQSFFGGDRHARVV 241 +R NHS+P K P PF +++ECDESL LHYL GW ++A LLQ+ GGD H RVV Sbjct: 61 YRINHSRPRKSPFPFPKRTECDESLLLHYLSNGWLNDARNLLQNSSGGDLHLRVV 115 >XP_004511762.1 PREDICTED: pentatricopeptide repeat-containing protein At1g32415, mitochondrial [Cicer arietinum] Length = 741 Score = 55.8 bits (133), Expect = 8e-07 Identities = 29/53 (54%), Positives = 33/53 (62%) Frame = +2 Query: 83 SNHSQPSKPPLPFTRKSECDESLHLHYLMKGWHHEA*ELLQSFFGGDRHARVV 241 SNHS KP PF K E DES HYL KG HHEA ++LQ+F + H RVV Sbjct: 27 SNHSHSFKPLFPFPPKHEFDESQLFHYLTKGLHHEARKILQTFPCKNPHTRVV 79