BLASTX nr result
ID: Glycyrrhiza36_contig00029565
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00029565 (397 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004493649.1 PREDICTED: mediator of RNA polymerase II transcri... 87 3e-17 XP_013449700.1 mediator of RNA polymerase II transcription subun... 78 3e-14 XP_016205927.1 PREDICTED: mediator of RNA polymerase II transcri... 76 1e-13 XP_019419371.1 PREDICTED: mediator of RNA polymerase II transcri... 76 2e-13 XP_016205928.1 PREDICTED: mediator of RNA polymerase II transcri... 76 2e-13 KOM48818.1 hypothetical protein LR48_Vigan07g252200 [Vigna angul... 73 2e-13 BAT82466.1 hypothetical protein VIGAN_03248900 [Vigna angularis ... 73 2e-13 KDP40093.1 hypothetical protein JCGZ_02091 [Jatropha curcas] 75 3e-13 XP_012069510.1 PREDICTED: mediator of RNA polymerase II transcri... 75 3e-13 GAU20110.1 hypothetical protein TSUD_140100, partial [Trifolium ... 75 5e-13 BAT90298.1 hypothetical protein VIGAN_06151700 [Vigna angularis ... 70 6e-13 XP_016197395.1 PREDICTED: mediator of RNA polymerase II transcri... 74 6e-13 XP_015939682.1 PREDICTED: mediator of RNA polymerase II transcri... 74 6e-13 XP_016196563.1 PREDICTED: mediator of RNA polymerase II transcri... 74 6e-13 XP_016197394.1 PREDICTED: mediator of RNA polymerase II transcri... 74 6e-13 XP_015958679.1 PREDICTED: mediator of RNA polymerase II transcri... 74 9e-13 KRH20923.1 hypothetical protein GLYMA_13G209800 [Glycine max] 74 9e-13 OIV92578.1 hypothetical protein TanjilG_02341 [Lupinus angustifo... 74 9e-13 XP_006594439.1 PREDICTED: mediator of RNA polymerase II transcri... 74 9e-13 XP_010255865.1 PREDICTED: mediator of RNA polymerase II transcri... 74 9e-13 >XP_004493649.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Cicer arietinum] Length = 1339 Score = 86.7 bits (213), Expect = 3e-17 Identities = 43/67 (64%), Positives = 49/67 (73%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLLXXXXXXXXXXXXXXX 182 YVSGFV LMVGCTPMWVRE D++LLKRLS+GLR+L+EHELALRLL Sbjct: 1273 YVSGFVGLMVGCTPMWVREADVELLKRLSKGLRQLDEHELALRLLEIGGIGVMGAAAEMI 1332 Query: 183 IQFERRL 203 I+ ERRL Sbjct: 1333 IEIERRL 1339 >XP_013449700.1 mediator of RNA polymerase II transcription subunit 33A [Medicago truncatula] KEH23728.1 mediator of RNA polymerase II transcription subunit 33A [Medicago truncatula] Length = 1338 Score = 78.2 bits (191), Expect = 3e-14 Identities = 37/45 (82%), Positives = 42/45 (93%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSL+V CTPMW+REVD +LLKRLS+GLR+LNE ELALRLL Sbjct: 1272 YVSGFVSLIVCCTPMWIREVDAELLKRLSKGLRQLNEDELALRLL 1316 >XP_016205927.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33B-like [Arachis ipaensis] Length = 414 Score = 75.9 bits (185), Expect = 1e-13 Identities = 33/45 (73%), Positives = 42/45 (93%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGF+SL+V CTP+WV E+D+D+LKRLS+GL ++NEHELALRLL Sbjct: 348 YVSGFLSLIVSCTPLWVSEIDVDILKRLSKGLIQMNEHELALRLL 392 >XP_019419371.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Lupinus angustifolius] OIV95872.1 hypothetical protein TanjilG_06848 [Lupinus angustifolius] Length = 1329 Score = 75.9 bits (185), Expect = 2e-13 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD+D+LKRLS GLR LNE ELAL LL Sbjct: 1265 YVSGFVSLMVGCTPNWVLEVDVDVLKRLSNGLRRLNEEELALALL 1309 >XP_016205928.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis ipaensis] Length = 1334 Score = 75.9 bits (185), Expect = 2e-13 Identities = 33/45 (73%), Positives = 42/45 (93%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGF+SL+V CTP+WV E+D+D+LKRLS+GL ++NEHELALRLL Sbjct: 1268 YVSGFLSLIVSCTPLWVSEIDVDILKRLSKGLIQMNEHELALRLL 1312 >KOM48818.1 hypothetical protein LR48_Vigan07g252200 [Vigna angularis] Length = 181 Score = 72.8 bits (177), Expect = 2e-13 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMV CTP WV EVDM +LKRLS GLR+LNE ELAL LL Sbjct: 117 YVSGFVSLMVDCTPNWVLEVDMHVLKRLSNGLRQLNEEELALALL 161 >BAT82466.1 hypothetical protein VIGAN_03248900 [Vigna angularis var. angularis] Length = 187 Score = 72.8 bits (177), Expect = 2e-13 Identities = 36/45 (80%), Positives = 38/45 (84%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMV CTP WV EVDM +LKRLS GLR+LNE ELAL LL Sbjct: 123 YVSGFVSLMVDCTPNWVLEVDMHVLKRLSNGLRQLNEEELALALL 167 >KDP40093.1 hypothetical protein JCGZ_02091 [Jatropha curcas] Length = 650 Score = 75.1 bits (183), Expect = 3e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD D+LKRLS+GLR+ NE ELAL LL Sbjct: 587 YVSGFVSLMVGCTPSWVMEVDADVLKRLSKGLRQWNEEELALALL 631 >XP_012069510.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A [Jatropha curcas] Length = 1323 Score = 75.1 bits (183), Expect = 3e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD D+LKRLS+GLR+ NE ELAL LL Sbjct: 1260 YVSGFVSLMVGCTPSWVMEVDADVLKRLSKGLRQWNEEELALALL 1304 >GAU20110.1 hypothetical protein TSUD_140100, partial [Trifolium subterraneum] Length = 1330 Score = 74.7 bits (182), Expect = 5e-13 Identities = 36/45 (80%), Positives = 40/45 (88%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD+++LKRLS GLR+LNE ELAL LL Sbjct: 1266 YVSGFVSLMVGCTPNWVLEVDVNVLKRLSNGLRQLNEEELALSLL 1310 >BAT90298.1 hypothetical protein VIGAN_06151700 [Vigna angularis var. angularis] Length = 137 Score = 70.5 bits (171), Expect = 6e-13 Identities = 35/45 (77%), Positives = 38/45 (84%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMV CTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 73 YVSGFVSLMVDCTPNWVLEVDVHVLKRLSNGLRQLNEEELALVLL 117 >XP_016197395.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Arachis ipaensis] Length = 1131 Score = 74.3 bits (181), Expect = 6e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1067 YVSGFVSLMVGCTPNWVLEVDVSVLKRLSNGLRQLNEEELALSLL 1111 >XP_015939682.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis duranensis] Length = 1320 Score = 74.3 bits (181), Expect = 6e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLM+GCTP+WV EVD+D+LKRLS GLR+L E ELAL LL Sbjct: 1256 YVSGFVSLMIGCTPIWVLEVDVDVLKRLSNGLRQLYEEELALALL 1300 >XP_016196563.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like [Arachis ipaensis] Length = 1324 Score = 74.3 bits (181), Expect = 6e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLM+GCTP+WV EVD+D+LKRLS GLR+L E ELAL LL Sbjct: 1260 YVSGFVSLMIGCTPIWVLEVDVDVLKRLSNGLRQLYEEELALALL 1304 >XP_016197394.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X1 [Arachis ipaensis] Length = 1331 Score = 74.3 bits (181), Expect = 6e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1267 YVSGFVSLMVGCTPNWVLEVDVSVLKRLSNGLRQLNEEELALSLL 1311 >XP_015958679.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Arachis duranensis] Length = 1131 Score = 73.9 bits (180), Expect = 9e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1067 YVSGFVSLMVGCTPNWVLEVDVSVLKRLSMGLRQLNEEELALSLL 1111 >KRH20923.1 hypothetical protein GLYMA_13G209800 [Glycine max] Length = 1132 Score = 73.9 bits (180), Expect = 9e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1068 YVSGFVSLMVGCTPNWVLEVDVHVLKRLSNGLRQLNEEELALALL 1112 >OIV92578.1 hypothetical protein TanjilG_02341 [Lupinus angustifolius] Length = 1187 Score = 73.9 bits (180), Expect = 9e-13 Identities = 35/45 (77%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YV+GFVSLMV CTP+WV EVD D+LKRLSRGL LNE+ELA RLL Sbjct: 1121 YVTGFVSLMVACTPLWVPEVDADILKRLSRGLIRLNEYELAFRLL 1165 >XP_006594439.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A-like isoform X2 [Glycine max] Length = 1195 Score = 73.9 bits (180), Expect = 9e-13 Identities = 36/45 (80%), Positives = 39/45 (86%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EVD+ +LKRLS GLR+LNE ELAL LL Sbjct: 1131 YVSGFVSLMVGCTPNWVLEVDVHVLKRLSNGLRQLNEEELALALL 1175 >XP_010255865.1 PREDICTED: mediator of RNA polymerase II transcription subunit 33A isoform X3 [Nelumbo nucifera] Length = 1213 Score = 73.9 bits (180), Expect = 9e-13 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +3 Query: 3 YVSGFVSLMVGCTPMWVREVDMDLLKRLSRGLRELNEHELALRLL 137 YVSGFVSLMVGCTP WV EV++D+LKRLS+GLR+ NE ELAL LL Sbjct: 1149 YVSGFVSLMVGCTPTWVLEVEVDVLKRLSKGLRQWNEEELALALL 1193