BLASTX nr result
ID: Glycyrrhiza36_contig00029542
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00029542 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN42349.1 hypothetical protein glysoja_020061 [Glycine soja] KR... 64 1e-11 KRH77953.1 hypothetical protein GLYMA_01G244000 [Glycine max] 62 5e-11 XP_007143067.1 hypothetical protein PHAVU_007G041100g [Phaseolus... 59 8e-10 KHN30424.1 hypothetical protein glysoja_033162 [Glycine soja] 49 5e-06 >KHN42349.1 hypothetical protein glysoja_020061 [Glycine soja] KRG91041.1 hypothetical protein GLYMA_20G130100 [Glycine max] Length = 63 Score = 63.5 bits (153), Expect = 1e-11 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = -2 Query: 246 IIIFFLLSCSIEVEGVRPLREQSAAPSFVSLIINRAYSGPSHRGRGH 106 I + LLS S VE R L++QS++P+F+ LIINRAYSGPSHRG GH Sbjct: 17 IFLLLLLSYSNNVESTRTLKDQSSSPAFIGLIINRAYSGPSHRGAGH 63 >KRH77953.1 hypothetical protein GLYMA_01G244000 [Glycine max] Length = 59 Score = 61.6 bits (148), Expect = 5e-11 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -2 Query: 219 SIEVEGVRPLREQSAAPSFVSLIINRAYSGPSHRGRGH 106 SI+VEG+RPL+ A PSF+SLIINRAYSGPSHRGRGH Sbjct: 25 SIKVEGMRPLK---ADPSFISLIINRAYSGPSHRGRGH 59 >XP_007143067.1 hypothetical protein PHAVU_007G041100g [Phaseolus vulgaris] ESW15061.1 hypothetical protein PHAVU_007G041100g [Phaseolus vulgaris] Length = 58 Score = 58.5 bits (140), Expect = 8e-10 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -2 Query: 243 IIFFLLSCSIEVEGVRPLREQSAAPSFVSLIINRAYSGPSHRGRGH 106 + LLS S VE + L++Q ++PSF++L INRAYSGPSHRGRGH Sbjct: 13 LFVLLLSYSNYVEARKSLKDQYSSPSFIALFINRAYSGPSHRGRGH 58 >KHN30424.1 hypothetical protein glysoja_033162 [Glycine soja] Length = 61 Score = 48.9 bits (115), Expect = 5e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +1 Query: 97 LQSVAASSVAWPRISPVDN*TYEGGSCRLLSERSHALHLDGARKQE 234 + S+ ASSVAWPRISPVD TYEG + +RSH+L+LDG + + Sbjct: 9 VSSMTASSVAWPRISPVDYQTYEGW---ISFQRSHSLNLDGGVRDQ 51