BLASTX nr result
ID: Glycyrrhiza36_contig00028108
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00028108 (563 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004489561.1 PREDICTED: uncharacterized membrane protein At3g2... 72 3e-11 XP_004489560.1 PREDICTED: uncharacterized membrane protein At3g2... 72 3e-11 XP_007151582.1 hypothetical protein PHAVU_004G058900g [Phaseolus... 68 6e-10 KHN30247.1 Putative membrane protein [Glycine soja] 65 4e-09 XP_003555008.1 PREDICTED: uncharacterized membrane protein At3g2... 65 4e-09 XP_017437840.1 PREDICTED: uncharacterized membrane protein At3g2... 64 2e-08 XP_014505793.1 PREDICTED: uncharacterized membrane protein At3g2... 63 2e-08 XP_019429114.1 PREDICTED: uncharacterized membrane protein At3g2... 61 1e-07 XP_019429113.1 PREDICTED: uncharacterized membrane protein At3g2... 61 1e-07 XP_019429112.1 PREDICTED: uncharacterized membrane protein At3g2... 61 1e-07 XP_015946463.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized m... 60 3e-07 XP_016181502.1 PREDICTED: uncharacterized membrane protein At3g2... 60 3e-07 GAU49608.1 hypothetical protein TSUD_286500 [Trifolium subterran... 58 1e-06 XP_015879044.1 PREDICTED: uncharacterized membrane protein At3g2... 58 2e-06 JAT57076.1 putative membrane protein At3g27390 [Anthurium amnicola] 58 2e-06 CDP16635.1 unnamed protein product [Coffea canephora] 55 3e-06 XP_017438206.1 PREDICTED: uncharacterized membrane protein At3g2... 53 6e-06 XP_017258208.1 PREDICTED: uncharacterized membrane protein At3g2... 56 7e-06 XP_006447209.1 hypothetical protein CICLE_v10014727mg [Citrus cl... 55 8e-06 KDO45669.1 hypothetical protein CISIN_1g007958mg [Citrus sinensis] 55 9e-06 >XP_004489561.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X2 [Cicer arietinum] Length = 544 Score = 71.6 bits (174), Expect = 3e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP EFWASLWSFICFLPYFIGLWLLGNIK Sbjct: 1 MEPPKEFWASLWSFICFLPYFIGLWLLGNIK 31 >XP_004489560.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X1 [Cicer arietinum] Length = 571 Score = 71.6 bits (174), Expect = 3e-11 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP EFWASLWSFICFLPYFIGLWLLGNIK Sbjct: 1 MEPPKEFWASLWSFICFLPYFIGLWLLGNIK 31 >XP_007151582.1 hypothetical protein PHAVU_004G058900g [Phaseolus vulgaris] ESW23576.1 hypothetical protein PHAVU_004G058900g [Phaseolus vulgaris] Length = 585 Score = 67.8 bits (164), Expect = 6e-10 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP+ FWASLW+F+CFLP+FIGLWLLGNIK Sbjct: 1 MEPPIGFWASLWNFVCFLPFFIGLWLLGNIK 31 >KHN30247.1 Putative membrane protein [Glycine soja] Length = 578 Score = 65.5 bits (158), Expect = 4e-09 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FWAS+W+F+CFLP+F+GLWLLGNIK Sbjct: 1 MEPPTGFWASIWNFVCFLPFFVGLWLLGNIK 31 >XP_003555008.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X2 [Glycine max] KRG93983.1 hypothetical protein GLYMA_19G054500 [Glycine max] Length = 578 Score = 65.5 bits (158), Expect = 4e-09 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FWAS+W+F+CFLP+F+GLWLLGNIK Sbjct: 1 MEPPTGFWASIWNFVCFLPFFVGLWLLGNIK 31 >XP_017437840.1 PREDICTED: uncharacterized membrane protein At3g27390-like [Vigna angularis] BAU01588.1 hypothetical protein VIGAN_11085300 [Vigna angularis var. angularis] Length = 584 Score = 63.5 bits (153), Expect = 2e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FWAS+W+ +CFLP+FIGLWLLGNIK Sbjct: 1 MEPPTGFWASIWNLVCFLPFFIGLWLLGNIK 31 >XP_014505793.1 PREDICTED: uncharacterized membrane protein At3g27390-like [Vigna radiata var. radiata] Length = 584 Score = 63.2 bits (152), Expect = 2e-08 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FWAS+W+ +CFLP+FIGLWLLGNIK Sbjct: 1 MEPPTGFWASVWNLVCFLPFFIGLWLLGNIK 31 >XP_019429114.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X3 [Lupinus angustifolius] Length = 571 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FWASLWSF+CFLPYFIGL++LG++K Sbjct: 1 MEPPKGFWASLWSFLCFLPYFIGLFILGHVK 31 >XP_019429113.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X2 [Lupinus angustifolius] Length = 574 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FWASLWSF+CFLPYFIGL++LG++K Sbjct: 1 MEPPKGFWASLWSFLCFLPYFIGLFILGHVK 31 >XP_019429112.1 PREDICTED: uncharacterized membrane protein At3g27390-like isoform X1 [Lupinus angustifolius] Length = 578 Score = 61.2 bits (147), Expect = 1e-07 Identities = 24/31 (77%), Positives = 29/31 (93%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FWASLWSF+CFLPYFIGL++LG++K Sbjct: 1 MEPPKGFWASLWSFLCFLPYFIGLFILGHVK 31 >XP_015946463.1 PREDICTED: LOW QUALITY PROTEIN: uncharacterized membrane protein At3g27390 [Arachis duranensis] Length = 579 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP WASLWSFICFLPYFIGL LLG IK Sbjct: 1 MEPPKGIWASLWSFICFLPYFIGLMLLGTIK 31 >XP_016181502.1 PREDICTED: uncharacterized membrane protein At3g27390 [Arachis ipaensis] Length = 584 Score = 59.7 bits (143), Expect = 3e-07 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP WASLWSFICFLPYFIGL LLG IK Sbjct: 1 MEPPKGIWASLWSFICFLPYFIGLMLLGTIK 31 >GAU49608.1 hypothetical protein TSUD_286500 [Trifolium subterraneum] Length = 392 Score = 58.2 bits (139), Expect = 1e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP +FW+SLWS +CFLPYFI L++LGNIK Sbjct: 1 MEPPEDFWSSLWSLLCFLPYFICLFILGNIK 31 >XP_015879044.1 PREDICTED: uncharacterized membrane protein At3g27390 [Ziziphus jujuba] XP_015879045.1 PREDICTED: uncharacterized membrane protein At3g27390 [Ziziphus jujuba] XP_015879046.1 PREDICTED: uncharacterized membrane protein At3g27390 [Ziziphus jujuba] Length = 587 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP F ASLW+FICFLPYFIGL++LGNIK Sbjct: 1 MEPPRGFLASLWNFICFLPYFIGLFILGNIK 31 >JAT57076.1 putative membrane protein At3g27390 [Anthurium amnicola] Length = 598 Score = 57.8 bits (138), Expect = 2e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +1 Query: 460 GCVMEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 G +MEPP FWAS+WSF CFLP+F+GL LLG +K Sbjct: 14 GQIMEPPRGFWASIWSFFCFLPFFVGLLLLGIVK 47 >CDP16635.1 unnamed protein product [Coffea canephora] Length = 194 Score = 55.5 bits (132), Expect = 3e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP F+ASLWSFICFLPYFIGL +LG IK Sbjct: 1 MEPPRGFFASLWSFICFLPYFIGLLILGFIK 31 >XP_017438206.1 PREDICTED: uncharacterized membrane protein At3g27390-like [Vigna angularis] Length = 97 Score = 52.8 bits (125), Expect = 6e-06 Identities = 24/31 (77%), Positives = 26/31 (83%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP F ASLWSF+ FLPYFIGL LLG+IK Sbjct: 1 MEPPTGFCASLWSFVRFLPYFIGLLLLGSIK 31 >XP_017258208.1 PREDICTED: uncharacterized membrane protein At3g27390 [Daucus carota subsp. sativus] KZM90887.1 hypothetical protein DCAR_021748 [Daucus carota subsp. sativus] Length = 580 Score = 55.8 bits (133), Expect = 7e-06 Identities = 23/31 (74%), Positives = 26/31 (83%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP FW+SLW FICFLP+FIGL LLG +K Sbjct: 1 MEPPTGFWSSLWRFICFLPFFIGLLLLGLLK 31 >XP_006447209.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] XP_006447210.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] XP_006447215.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] XP_006447216.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] ESR60449.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] ESR60450.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] ESR60455.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] ESR60456.1 hypothetical protein CICLE_v10014727mg [Citrus clementina] KDO45670.1 hypothetical protein CISIN_1g007958mg [Citrus sinensis] KDO45671.1 hypothetical protein CISIN_1g007958mg [Citrus sinensis] Length = 360 Score = 55.5 bits (132), Expect = 8e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP F ASLWSFICFLPYFIGL LLG IK Sbjct: 1 MEPPKGFLASLWSFICFLPYFIGLLLLGIIK 31 >KDO45669.1 hypothetical protein CISIN_1g007958mg [Citrus sinensis] Length = 411 Score = 55.5 bits (132), Expect = 9e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 469 MEPPVEFWASLWSFICFLPYFIGLWLLGNIK 561 MEPP F ASLWSFICFLPYFIGL LLG IK Sbjct: 1 MEPPKGFLASLWSFICFLPYFIGLLLLGIIK 31