BLASTX nr result
ID: Glycyrrhiza36_contig00028100
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00028100 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_014627418.1 PREDICTED: WAT1-related protein At3g28050-like is... 57 1e-07 KRG93362.1 hypothetical protein GLYMA_19G011500 [Glycine max] 57 1e-07 XP_003553929.1 PREDICTED: WAT1-related protein At3g28050-like is... 57 1e-07 KYP50526.1 Auxin-induced protein 5NG4 [Cajanus cajan] 57 2e-07 GAU47308.1 hypothetical protein TSUD_283770 [Trifolium subterran... 55 8e-07 XP_016203247.1 PREDICTED: WAT1-related protein At3g28050-like [A... 55 8e-07 GAU10031.1 hypothetical protein TSUD_281850 [Trifolium subterran... 54 1e-06 GAU47303.1 hypothetical protein TSUD_283720 [Trifolium subterran... 54 1e-06 XP_015967106.1 PREDICTED: WAT1-related protein At3g28050-like [A... 52 5e-06 >XP_014627418.1 PREDICTED: WAT1-related protein At3g28050-like isoform X2 [Glycine max] Length = 304 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 M RGW FYKD LPVVVIIGNE NDMG TLFK Sbjct: 1 MQRGWSFYKDFLPVVVIIGNEFNDMGTLTLFK 32 >KRG93362.1 hypothetical protein GLYMA_19G011500 [Glycine max] Length = 331 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 M RGW FYKD LPVVVIIGNE NDMG TLFK Sbjct: 1 MQRGWSFYKDFLPVVVIIGNEFNDMGTLTLFK 32 >XP_003553929.1 PREDICTED: WAT1-related protein At3g28050-like isoform X1 [Glycine max] KHN23568.1 Auxin-induced protein 5NG4 [Glycine soja] KRG93361.1 hypothetical protein GLYMA_19G011500 [Glycine max] Length = 366 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/32 (81%), Positives = 26/32 (81%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 M RGW FYKD LPVVVIIGNE NDMG TLFK Sbjct: 1 MQRGWSFYKDFLPVVVIIGNEFNDMGTLTLFK 32 >KYP50526.1 Auxin-induced protein 5NG4 [Cajanus cajan] Length = 368 Score = 56.6 bits (135), Expect = 2e-07 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 MA W Y+D+LPVVVIIGNECNDMGL TLFK Sbjct: 1 MATQWSLYRDVLPVVVIIGNECNDMGLLTLFK 32 >GAU47308.1 hypothetical protein TSUD_283770 [Trifolium subterraneum] Length = 369 Score = 54.7 bits (130), Expect = 8e-07 Identities = 25/32 (78%), Positives = 25/32 (78%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 M R W FY D LPVVVIIGNEC DMGL TLFK Sbjct: 1 MTRTWSFYMDFLPVVVIIGNECIDMGLLTLFK 32 >XP_016203247.1 PREDICTED: WAT1-related protein At3g28050-like [Arachis ipaensis] Length = 371 Score = 54.7 bits (130), Expect = 8e-07 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 MAR W FYK+LLP++++IG ECNDMGL TLFK Sbjct: 1 MARRWSFYKNLLPILLLIGIECNDMGLLTLFK 32 >GAU10031.1 hypothetical protein TSUD_281850 [Trifolium subterraneum] Length = 349 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 M R W FY D LPV+VIIGNEC DMGL TLFK Sbjct: 1 MTRRWSFYMDFLPVIVIIGNECIDMGLLTLFK 32 >GAU47303.1 hypothetical protein TSUD_283720 [Trifolium subterraneum] Length = 987 Score = 54.3 bits (129), Expect = 1e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 M R W FY D LPV+VIIGNEC DMGL TLFK Sbjct: 1 MTRRWSFYMDFLPVIVIIGNECIDMGLLTLFK 32 >XP_015967106.1 PREDICTED: WAT1-related protein At3g28050-like [Arachis duranensis] Length = 371 Score = 52.4 bits (124), Expect = 5e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +1 Query: 151 MARGWFFYKDLLPVVVIIGNECNDMGLFTLFK 246 MAR W FYK+LLP++++I ECNDMGL TLFK Sbjct: 1 MARRWSFYKNLLPILLLISIECNDMGLLTLFK 32