BLASTX nr result
ID: Glycyrrhiza36_contig00027898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027898 (461 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONI33713.1 hypothetical protein PRUPE_1G442800 [Prunus persica] 76 1e-15 >ONI33713.1 hypothetical protein PRUPE_1G442800 [Prunus persica] Length = 70 Score = 76.3 bits (186), Expect = 1e-15 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = -2 Query: 142 VYVNQDVSCNDLFILKVPISNWLALKMQIWLLPFPWGQHC 23 +Y +D C+DLF+LKVPISNWLALKMQIWLL FPWGQHC Sbjct: 7 IYSIKDAGCHDLFVLKVPISNWLALKMQIWLLHFPWGQHC 46