BLASTX nr result
ID: Glycyrrhiza36_contig00027837
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027837 (447 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH43782.1 hypothetical protein GLYMA_08G171600 [Glycine max] 66 4e-11 KHN26821.1 BTB/POZ domain-containing protein [Glycine soja] 66 4e-11 XP_014633903.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-co... 66 7e-10 XP_006598193.1 PREDICTED: BTB/POZ domain-containing protein At1g... 66 1e-09 XP_006598187.1 PREDICTED: BTB/POZ domain-containing protein At1g... 66 1e-09 KYP49111.1 hypothetical protein KK1_029143 [Cajanus cajan] 65 1e-09 XP_017425376.1 PREDICTED: BTB/POZ domain-containing protein At1g... 65 2e-09 KOM42602.1 hypothetical protein LR48_Vigan05g020600 [Vigna angul... 65 2e-09 XP_017425375.1 PREDICTED: BTB/POZ domain-containing protein At1g... 65 3e-09 XP_017425374.1 PREDICTED: BTB/POZ domain-containing protein At1g... 65 3e-09 XP_017425366.1 PREDICTED: BTB/POZ domain-containing protein At1g... 65 3e-09 XP_013464317.1 BTB/POZ domain protein [Medicago truncatula] KEH3... 64 6e-09 XP_013464316.1 BTB/POZ domain protein [Medicago truncatula] KEH3... 64 6e-09 XP_013464312.1 BTB/POZ domain protein [Medicago truncatula] KEH3... 64 6e-09 XP_013464311.1 BTB/POZ domain protein [Medicago truncatula] KEH3... 64 6e-09 XP_014501741.1 PREDICTED: BTB/POZ domain-containing protein At1g... 64 6e-09 XP_013464310.1 BTB/POZ domain protein [Medicago truncatula] KEH3... 64 6e-09 XP_007149273.1 hypothetical protein PHAVU_005G056400g [Phaseolus... 60 8e-08 XP_019443734.1 PREDICTED: BTB/POZ domain-containing protein At1g... 59 3e-07 XP_019443733.1 PREDICTED: BTB/POZ domain-containing protein At1g... 59 3e-07 >KRH43782.1 hypothetical protein GLYMA_08G171600 [Glycine max] Length = 128 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 K +EK+ I SH+ TLHRRLLHALNLG+RHFDEKT RWK Sbjct: 7 KEKEKEKDRCISSHMQTLHRRLLHALNLGTRHFDEKTCRWK 47 >KHN26821.1 BTB/POZ domain-containing protein [Glycine soja] Length = 128 Score = 66.2 bits (160), Expect = 4e-11 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 K +EK+ I SH+ TLHRRLLHALNLG+RHFDEKT RWK Sbjct: 7 KEKEKEKDRCISSHMQTLHRRLLHALNLGTRHFDEKTCRWK 47 >XP_014633903.1 PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At1g04390-like [Glycine max] Length = 549 Score = 66.2 bits (160), Expect = 7e-10 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 K +EK+ I SH+ TLHRRLLHALNLG+RHFDEKT RWK Sbjct: 7 KEKEKEKDRCISSHMQTLHRRLLHALNLGTRHFDEKTCRWK 47 >XP_006598193.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Glycine max] XP_014623406.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Glycine max] XP_014623407.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Glycine max] KRH13662.1 hypothetical protein GLYMA_15G255000 [Glycine max] Length = 1000 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/42 (76%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = -1 Query: 117 SSREKES----IIGSHVHTLHRRLLHALNLGSRHFDEKTNRW 4 SSREKE I SH+ TLHRRLLHALNLG+RHFDEKTNRW Sbjct: 3 SSREKEKENDRCISSHMQTLHRRLLHALNLGTRHFDEKTNRW 44 >XP_006598187.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598188.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598190.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598191.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_006598192.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_003545911.2 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] XP_014623405.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Glycine max] KRH13663.1 hypothetical protein GLYMA_15G255000 [Glycine max] KRH13664.1 hypothetical protein GLYMA_15G255000 [Glycine max] Length = 1020 Score = 65.9 bits (159), Expect = 1e-09 Identities = 32/42 (76%), Positives = 34/42 (80%), Gaps = 4/42 (9%) Frame = -1 Query: 117 SSREKES----IIGSHVHTLHRRLLHALNLGSRHFDEKTNRW 4 SSREKE I SH+ TLHRRLLHALNLG+RHFDEKTNRW Sbjct: 3 SSREKEKENDRCISSHMQTLHRRLLHALNLGTRHFDEKTNRW 44 >KYP49111.1 hypothetical protein KK1_029143 [Cajanus cajan] Length = 739 Score = 65.5 bits (158), Expect = 1e-09 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 117 SSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 S RE + SH+ TLHRRLLHALNLG+RHFDEKTN+WK Sbjct: 3 SGRESDRSFSSHMQTLHRRLLHALNLGTRHFDEKTNKWK 41 >XP_017425376.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X4 [Vigna angularis] Length = 633 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 + +E + I SH+ TLHRRL+HALNLG+RHFDEKTNRW+ Sbjct: 5 RDKEKENDRCISSHMQTLHRRLIHALNLGTRHFDEKTNRWR 45 >KOM42602.1 hypothetical protein LR48_Vigan05g020600 [Vigna angularis] Length = 749 Score = 64.7 bits (156), Expect = 2e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 + +E + I SH+ TLHRRL+HALNLG+RHFDEKTNRW+ Sbjct: 5 RDKEKENDRCISSHMQTLHRRLIHALNLGTRHFDEKTNRWR 45 >XP_017425375.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X3 [Vigna angularis] Length = 875 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 + +E + I SH+ TLHRRL+HALNLG+RHFDEKTNRW+ Sbjct: 5 RDKEKENDRCISSHMQTLHRRLIHALNLGTRHFDEKTNRWR 45 >XP_017425374.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X2 [Vigna angularis] Length = 942 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 + +E + I SH+ TLHRRL+HALNLG+RHFDEKTNRW+ Sbjct: 5 RDKEKENDRCISSHMQTLHRRLIHALNLGTRHFDEKTNRWR 45 >XP_017425366.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425367.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425368.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425370.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425371.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425372.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] XP_017425373.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna angularis] BAT93277.1 hypothetical protein VIGAN_07221800 [Vigna angularis var. angularis] Length = 1009 Score = 64.7 bits (156), Expect = 3e-09 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 + +E + I SH+ TLHRRL+HALNLG+RHFDEKTNRW+ Sbjct: 5 RDKEKENDRCISSHMQTLHRRLIHALNLGTRHFDEKTNRWR 45 >XP_013464317.1 BTB/POZ domain protein [Medicago truncatula] KEH38352.1 BTB/POZ domain protein [Medicago truncatula] Length = 488 Score = 63.5 bits (153), Expect = 6e-09 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -1 Query: 144 IHSF*GMKSSSREKESI--IGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 IHS ++S+EK++ + SH+ TLHRRLLH+LNLG+R+FDEKTNRWK Sbjct: 2 IHSTVKSATASKEKDNYRSLSSHIITLHRRLLHSLNLGTRYFDEKTNRWK 51 >XP_013464316.1 BTB/POZ domain protein [Medicago truncatula] KEH38351.1 BTB/POZ domain protein [Medicago truncatula] Length = 511 Score = 63.5 bits (153), Expect = 6e-09 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -1 Query: 144 IHSF*GMKSSSREKESI--IGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 IHS ++S+EK++ + SH+ TLHRRLLH+LNLG+R+FDEKTNRWK Sbjct: 2 IHSTVKSATASKEKDNYRSLSSHIITLHRRLLHSLNLGTRYFDEKTNRWK 51 >XP_013464312.1 BTB/POZ domain protein [Medicago truncatula] KEH38347.1 BTB/POZ domain protein [Medicago truncatula] Length = 665 Score = 63.5 bits (153), Expect = 6e-09 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -1 Query: 144 IHSF*GMKSSSREKESI--IGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 IHS ++S+EK++ + SH+ TLHRRLLH+LNLG+R+FDEKTNRWK Sbjct: 2 IHSTVKSATASKEKDNYRSLSSHIITLHRRLLHSLNLGTRYFDEKTNRWK 51 >XP_013464311.1 BTB/POZ domain protein [Medicago truncatula] KEH38346.1 BTB/POZ domain protein [Medicago truncatula] Length = 841 Score = 63.5 bits (153), Expect = 6e-09 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -1 Query: 144 IHSF*GMKSSSREKESI--IGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 IHS ++S+EK++ + SH+ TLHRRLLH+LNLG+R+FDEKTNRWK Sbjct: 2 IHSTVKSATASKEKDNYRSLSSHIITLHRRLLHSLNLGTRYFDEKTNRWK 51 >XP_014501741.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna radiata var. radiata] XP_014501742.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna radiata var. radiata] XP_014501743.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X1 [Vigna radiata var. radiata] Length = 1009 Score = 63.5 bits (153), Expect = 6e-09 Identities = 26/41 (63%), Positives = 32/41 (78%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 + +E + I SH+ LHRRLLHALNLG+RHFDEKTNRW+ Sbjct: 5 RDKEKENDRYISSHMQNLHRRLLHALNLGTRHFDEKTNRWR 45 >XP_013464310.1 BTB/POZ domain protein [Medicago truncatula] KEH38345.1 BTB/POZ domain protein [Medicago truncatula] Length = 1027 Score = 63.5 bits (153), Expect = 6e-09 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 2/50 (4%) Frame = -1 Query: 144 IHSF*GMKSSSREKESI--IGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 IHS ++S+EK++ + SH+ TLHRRLLH+LNLG+R+FDEKTNRWK Sbjct: 2 IHSTVKSATASKEKDNYRSLSSHIITLHRRLLHSLNLGTRYFDEKTNRWK 51 >XP_007149273.1 hypothetical protein PHAVU_005G056400g [Phaseolus vulgaris] ESW21267.1 hypothetical protein PHAVU_005G056400g [Phaseolus vulgaris] Length = 1011 Score = 60.5 bits (145), Expect = 8e-08 Identities = 24/41 (58%), Positives = 31/41 (75%) Frame = -1 Query: 123 KSSSREKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 + ++ + I SH+ TLHRRLLH LNLG+RHFDEKT RW+ Sbjct: 5 RDKEKQNDRCISSHMQTLHRRLLHTLNLGNRHFDEKTKRWR 45 >XP_019443734.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X4 [Lupinus angustifolius] Length = 826 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/43 (62%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -1 Query: 126 MKSSS-REKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 MKS+ ++ I H+ TLH RLLH LNLG+RHFDEKTNRWK Sbjct: 1 MKSTKDKDNNRCITLHIQTLHHRLLHELNLGTRHFDEKTNRWK 43 >XP_019443733.1 PREDICTED: BTB/POZ domain-containing protein At1g04390 isoform X3 [Lupinus angustifolius] Length = 842 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/43 (62%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -1 Query: 126 MKSSS-REKESIIGSHVHTLHRRLLHALNLGSRHFDEKTNRWK 1 MKS+ ++ I H+ TLH RLLH LNLG+RHFDEKTNRWK Sbjct: 1 MKSTKDKDNNRCITLHIQTLHHRLLHELNLGTRHFDEKTNRWK 43