BLASTX nr result
ID: Glycyrrhiza36_contig00027708
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027708 (441 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ALE30271.1 polygalacturonase inhibiting protein 5, partial [Medi... 65 8e-10 XP_013467253.1 polygalacturonase inhibitor protein [Medicago tru... 65 9e-10 XP_013445647.1 polygalacturonase inhibitor [Medicago truncatula]... 65 1e-09 GAU23452.1 hypothetical protein TSUD_331500 [Trifolium subterran... 65 2e-09 XP_012575553.1 PREDICTED: polygalacturonase inhibitor-like [Cice... 64 2e-09 GAU23453.1 hypothetical protein TSUD_331510 [Trifolium subterran... 64 2e-09 AFK46159.1 unknown [Medicago truncatula] 64 3e-09 XP_003625218.1 polygalacturonase inhibitor [Medicago truncatula]... 64 3e-09 GAU23455.1 hypothetical protein TSUD_331530 [Trifolium subterran... 64 3e-09 KYP39406.1 Polygalacturonase inhibitor [Cajanus cajan] 64 4e-09 GAU51088.1 hypothetical protein TSUD_371310 [Trifolium subterran... 63 4e-09 AAZ32892.1 polygalacturonase inhibitor protein, partial [Medicag... 61 1e-08 GAU28724.1 hypothetical protein TSUD_372310 [Trifolium subterran... 62 1e-08 KHN04831.1 Polygalacturonase inhibitor 1 [Glycine soja] 62 2e-08 XP_013467252.1 polygalacturonase inhibitor [Medicago truncatula]... 61 3e-08 KOM40318.1 hypothetical protein LR48_Vigan04g051600 [Vigna angul... 61 3e-08 AEZ54449.1 polygalacturonase-inhibiting protein 3, partial [Medi... 61 3e-08 XP_017421254.1 PREDICTED: polygalacturonase inhibitor-like [Vign... 61 3e-08 AEZ54447.1 polygalacturonase-inhibiting protein 1, partial [Medi... 61 3e-08 GAU36451.1 hypothetical protein TSUD_19860 [Trifolium subterraneum] 61 4e-08 >ALE30271.1 polygalacturonase inhibiting protein 5, partial [Medicago sativa subsp. x varia] Length = 267 Score = 65.1 bits (157), Expect = 8e-10 Identities = 33/51 (64%), Positives = 38/51 (74%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQL 155 LK L ISSTG+SG IP F Q K+L NL LS NH SG LP SLYKLP+L++ Sbjct: 66 LKTLTISSTGMSGTIPDFPVQMKNLFNLDLSSNHFSGSLPPSLYKLPKLEM 116 >XP_013467253.1 polygalacturonase inhibitor protein [Medicago truncatula] KEH41287.1 polygalacturonase inhibitor protein [Medicago truncatula] Length = 324 Score = 65.5 bits (158), Expect = 9e-10 Identities = 31/50 (62%), Positives = 38/50 (76%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 L+ L I +TG+SGPIP F+A+ KSL L LS NHLSG LP +LYKLP L+ Sbjct: 119 LRSLTIRATGISGPIPNFIAKLKSLTYLDLSENHLSGTLPHNLYKLPNLE 168 >XP_013445647.1 polygalacturonase inhibitor [Medicago truncatula] KEH19673.1 polygalacturonase inhibitor [Medicago truncatula] Length = 328 Score = 65.1 bits (157), Expect = 1e-09 Identities = 33/51 (64%), Positives = 39/51 (76%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQL 155 LK L ISSTG+SG IP F AQ K+L NL LS NH SG LP SL+KLP+L++ Sbjct: 120 LKTLTISSTGMSGTIPDFPAQMKNLFNLDLSSNHFSGSLPPSLFKLPKLEM 170 >GAU23452.1 hypothetical protein TSUD_331500 [Trifolium subterraneum] Length = 345 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/50 (62%), Positives = 40/50 (80%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I T VSGPIP FLA+ K+L+ L+LS N+LSGP+PSSL +LP+L+ Sbjct: 126 LKYLFIEYTNVSGPIPSFLAELKNLELLHLSTNNLSGPIPSSLSQLPKLE 175 >XP_012575553.1 PREDICTED: polygalacturonase inhibitor-like [Cicer arietinum] Length = 239 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/50 (66%), Positives = 38/50 (76%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L IS T V+GPIPKF AQF++L NL LS N+L G LP SLY+LP LQ Sbjct: 31 LKYLTISGTRVTGPIPKFTAQFENLVNLDLSHNNLFGTLPPSLYQLPSLQ 80 >GAU23453.1 hypothetical protein TSUD_331510 [Trifolium subterraneum] Length = 338 Score = 64.3 bits (155), Expect = 2e-09 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I T VSGPIP FLA+ K+L NL+LS N+LSGP+PS L +LP+L+ Sbjct: 124 LKYLYIEYTNVSGPIPPFLAELKNLQNLHLSTNNLSGPIPSVLSQLPKLE 173 >AFK46159.1 unknown [Medicago truncatula] Length = 342 Score = 63.9 bits (154), Expect = 3e-09 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I T VSGPIP FLAQ K+L L+LS N+LSGP+PSSL +LP L+ Sbjct: 128 LKYLFIEYTNVSGPIPPFLAQLKNLQLLHLSTNNLSGPIPSSLSQLPNLE 177 >XP_003625218.1 polygalacturonase inhibitor [Medicago truncatula] ABN08652.1 Leucine-rich repeat, plant specific [Medicago truncatula] AES81436.1 polygalacturonase inhibitor [Medicago truncatula] Length = 342 Score = 63.9 bits (154), Expect = 3e-09 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I T VSGPIP FLAQ K+L L+LS N+LSGP+PSSL +LP L+ Sbjct: 128 LKYLFIEYTNVSGPIPPFLAQLKNLQLLHLSTNNLSGPIPSSLSQLPNLE 177 >GAU23455.1 hypothetical protein TSUD_331530 [Trifolium subterraneum] Length = 343 Score = 63.9 bits (154), Expect = 3e-09 Identities = 32/50 (64%), Positives = 38/50 (76%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I T VSGPIP FLAQ K+L L+LS N+LSGP+PSSL +LP L+ Sbjct: 129 LKYLFIEYTNVSGPIPPFLAQLKNLQLLHLSTNNLSGPIPSSLSQLPNLE 178 >KYP39406.1 Polygalacturonase inhibitor [Cajanus cajan] Length = 335 Score = 63.5 bits (153), Expect = 4e-09 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRL 149 LK LI+++ +SGP+P FLAQ K+LD L LS N+LSGP+PSSL LP+L Sbjct: 127 LKYLILTNIAISGPVPSFLAQLKNLDTLDLSFNNLSGPIPSSLTTLPKL 175 >GAU51088.1 hypothetical protein TSUD_371310 [Trifolium subterraneum] Length = 274 Score = 63.2 bits (152), Expect = 4e-09 Identities = 33/49 (67%), Positives = 36/49 (73%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRL 149 L+ L ISSTG+SG IP F AQ K L NL LS NH SG LP SLYKLP+L Sbjct: 66 LRTLTISSTGMSGRIPNFPAQMKHLYNLDLSSNHFSGTLPHSLYKLPKL 114 >AAZ32892.1 polygalacturonase inhibitor protein, partial [Medicago sativa] Length = 176 Score = 60.8 bits (146), Expect = 1e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I T VSGPIP FLAQ K+L L+LS N+LSG +PSSL +LP L+ Sbjct: 64 LKYLFIEYTNVSGPIPPFLAQLKNLQLLHLSTNNLSGSIPSSLSQLPNLE 113 >GAU28724.1 hypothetical protein TSUD_372310 [Trifolium subterraneum] Length = 324 Score = 62.0 bits (149), Expect = 1e-08 Identities = 31/48 (64%), Positives = 36/48 (75%) Frame = +3 Query: 12 LIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQL 155 L I+STG+SGPIP F Q K L +L LS NH SG LP+SLYKLPRL + Sbjct: 119 LTITSTGLSGPIPNFPPQMKHLFSLDLSSNHFSGTLPNSLYKLPRLAI 166 >KHN04831.1 Polygalacturonase inhibitor 1 [Glycine soja] Length = 336 Score = 61.6 bits (148), Expect = 2e-08 Identities = 30/49 (61%), Positives = 39/49 (79%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRL 149 LK L +S+ +SGPIP F AQ K+LD++ LS N+LSGP+PSSL KLP+L Sbjct: 119 LKYLDLSNNNLSGPIPDFFAQLKNLDDIDLSFNNLSGPIPSSLGKLPKL 167 >XP_013467252.1 polygalacturonase inhibitor [Medicago truncatula] KEH41286.1 polygalacturonase inhibitor [Medicago truncatula] Length = 302 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I TG+SGPIP F+A+ KSL L LS NHLSG LP +L+ LP ++ Sbjct: 120 LKSLTIKKTGISGPIPNFMAKLKSLTFLDLSENHLSGTLPFNLFHLPNIE 169 >KOM40318.1 hypothetical protein LR48_Vigan04g051600 [Vigna angularis] Length = 336 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRL 149 L + S+TG+SGPIP+FLAQ K+L + LS N LSGP+PSSL +LP L Sbjct: 124 LTGIFFSNTGISGPIPEFLAQIKTLQYIELSSNRLSGPIPSSLSQLPNL 172 >AEZ54449.1 polygalacturonase-inhibiting protein 3, partial [Medicago sativa subsp. x varia] Length = 275 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 L+ L IS TGVSG IP F+A+ KSL L LS NHLSG LP +LY+LP L+ Sbjct: 80 LRTLSISGTGVSGRIPNFIAKLKSLTYLDLSDNHLSGTLPHNLYQLPNLE 129 >XP_017421254.1 PREDICTED: polygalacturonase inhibitor-like [Vigna angularis] Length = 356 Score = 61.2 bits (147), Expect = 3e-08 Identities = 29/49 (59%), Positives = 37/49 (75%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRL 149 L + S+TG+SGPIP+FLAQ K+L + LS N LSGP+PSSL +LP L Sbjct: 144 LTGIFFSNTGISGPIPEFLAQIKTLQYIELSSNRLSGPIPSSLSQLPNL 192 >AEZ54447.1 polygalacturonase-inhibiting protein 1, partial [Medicago sativa subsp. x varia] Length = 285 Score = 60.8 bits (146), Expect = 3e-08 Identities = 31/50 (62%), Positives = 37/50 (74%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 LK L I T VSGPIP FLAQ K+L L+LS N+LSG +PSSL +LP L+ Sbjct: 82 LKYLFIEYTNVSGPIPPFLAQLKNLQLLHLSTNNLSGSIPSSLSQLPNLE 131 >GAU36451.1 hypothetical protein TSUD_19860 [Trifolium subterraneum] Length = 329 Score = 60.8 bits (146), Expect = 4e-08 Identities = 28/50 (56%), Positives = 37/50 (74%) Frame = +3 Query: 3 LKQLIISSTGVSGPIPKFLAQFKSLDNLYLSRNHLSGPLPSSLYKLPRLQ 152 L+ L IS TG+SGP+P F+++ KSL L LS N LSG LP +LY+LP L+ Sbjct: 119 LRSLTISGTGISGPVPNFISKLKSLTYLDLSENRLSGTLPHNLYQLPNLE 168