BLASTX nr result
ID: Glycyrrhiza36_contig00027680
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027680 (269 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018830231.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 9e-06 XP_015950141.1 PREDICTED: pentatricopeptide repeat-containing pr... 52 9e-06 >XP_018830231.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18970 [Juglans regia] Length = 473 Score = 52.0 bits (123), Expect = 9e-06 Identities = 30/43 (69%), Positives = 33/43 (76%) Frame = -3 Query: 129 LPRLTCVSLLNSSLPKFTTNTVKQIHAQLITNALIKSPTILSK 1 LPRLTC SLLN + PK T VKQIHAQLITNAL K P +L+K Sbjct: 4 LPRLTCFSLLNHNTPK-TVRHVKQIHAQLITNAL-KVPFLLAK 44 >XP_015950141.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18970 [Arachis duranensis] XP_015950142.1 PREDICTED: pentatricopeptide repeat-containing protein At3g18970 [Arachis duranensis] Length = 482 Score = 52.0 bits (123), Expect = 9e-06 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -3 Query: 141 MVTHLPRLTCVSLLNSSLPKFTTNTVKQIHAQLITNALIKSPTILSK 1 M+T LPR +CV LL S LPKFT N VK++HAQLITN IKSP++L+K Sbjct: 7 MLTFLPRHSCVPLLYS-LPKFT-NHVKELHAQLITNG-IKSPSLLAK 50