BLASTX nr result
ID: Glycyrrhiza36_contig00027654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027654 (598 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004494495.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 2e-06 XP_018833993.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-06 >XP_004494495.1 PREDICTED: pentatricopeptide repeat-containing protein At2g20540-like [Cicer arietinum] Length = 432 Score = 57.8 bits (138), Expect = 2e-06 Identities = 29/39 (74%), Positives = 33/39 (84%) Frame = +3 Query: 3 ENDGGLYRLIADLYVIGEKWEEAERLTKMMMLGESVRQA 119 END GLY LIADLYVIGEKWEEAERL K +M+ E ++QA Sbjct: 384 ENDRGLYSLIADLYVIGEKWEEAERL-KELMVNERMKQA 421 >XP_018833993.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Juglans regia] Length = 437 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = +3 Query: 3 ENDGGLYRLIADLYVIGEKWEEAERLTKMMMLGESVRQA 119 ENDGG+Y LI+DLYV+GEKW+EAERL K +M E+VR+A Sbjct: 391 ENDGGVYSLISDLYVLGEKWDEAERLRK-LMAEENVRKA 428