BLASTX nr result
ID: Glycyrrhiza36_contig00027632
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza36_contig00027632 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH37589.1 hypothetical protein GLYMA_09G075800 [Glycine max] 54 6e-08 XP_006592286.1 PREDICTED: uncharacterized protein LOC100800997 i... 54 2e-06 KRH25100.1 hypothetical protein GLYMA_12G080600 [Glycine max] 54 2e-06 KYP68592.1 hypothetical protein KK1_022224 [Cajanus cajan] 54 2e-06 XP_004506066.1 PREDICTED: uncharacterized protein LOC101509010 [... 54 2e-06 XP_006592283.1 PREDICTED: uncharacterized protein LOC100800997 i... 54 2e-06 KHN21071.1 hypothetical protein glysoja_006550 [Glycine soja] 54 2e-06 KHN38710.1 hypothetical protein glysoja_008259 [Glycine soja] 53 4e-06 XP_006591112.1 PREDICTED: uncharacterized protein LOC100804513 [... 53 4e-06 >KRH37589.1 hypothetical protein GLYMA_09G075800 [Glycine max] Length = 60 Score = 54.3 bits (129), Expect = 6e-08 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 193 IDMDDPLDFEVEDDLLKPPPINNKRKKVI 279 +D +DPLDFEVEDDLLK PPINNKRKK+I Sbjct: 1 MDTNDPLDFEVEDDLLKCPPINNKRKKII 29 >XP_006592286.1 PREDICTED: uncharacterized protein LOC100800997 isoform X2 [Glycine max] XP_006592287.1 PREDICTED: uncharacterized protein LOC100800997 isoform X2 [Glycine max] Length = 380 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 193 IDMDDPLDFEVEDDLLKPPPINNKRKKVI 279 +D +DPLDFEVEDDLLK PPINNKRKK+I Sbjct: 1 MDTNDPLDFEVEDDLLKCPPINNKRKKII 29 >KRH25100.1 hypothetical protein GLYMA_12G080600 [Glycine max] Length = 387 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 193 IDMDDPLDFEVEDDLLKPPPINNKRKKVI 279 +D +DPLDFEVEDDLLK PPINNKRKK+I Sbjct: 1 MDTNDPLDFEVEDDLLKCPPINNKRKKII 29 >KYP68592.1 hypothetical protein KK1_022224 [Cajanus cajan] Length = 452 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 193 IDMDDPLDFEVEDDLLKPPPINNKRKKVI 279 +DM+DPLDFEVED LLK PPINNKRKK+I Sbjct: 1 MDMNDPLDFEVEDALLKSPPINNKRKKII 29 >XP_004506066.1 PREDICTED: uncharacterized protein LOC101509010 [Cicer arietinum] Length = 454 Score = 54.3 bits (129), Expect = 2e-06 Identities = 25/27 (92%), Positives = 25/27 (92%) Frame = +1 Query: 199 MDDPLDFEVEDDLLKPPPINNKRKKVI 279 MDDPLDFEVEDDLL P PINNKRKKVI Sbjct: 1 MDDPLDFEVEDDLLSPLPINNKRKKVI 27 >XP_006592283.1 PREDICTED: uncharacterized protein LOC100800997 isoform X1 [Glycine max] XP_006592284.1 PREDICTED: uncharacterized protein LOC100800997 isoform X1 [Glycine max] KRH25098.1 hypothetical protein GLYMA_12G080600 [Glycine max] KRH25099.1 hypothetical protein GLYMA_12G080600 [Glycine max] Length = 461 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 193 IDMDDPLDFEVEDDLLKPPPINNKRKKVI 279 +D +DPLDFEVEDDLLK PPINNKRKK+I Sbjct: 1 MDTNDPLDFEVEDDLLKCPPINNKRKKII 29 >KHN21071.1 hypothetical protein glysoja_006550 [Glycine soja] Length = 474 Score = 54.3 bits (129), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = +1 Query: 193 IDMDDPLDFEVEDDLLKPPPINNKRKKVI 279 +D +DPLDFEVEDDLLK PPINNKRKK+I Sbjct: 1 MDTNDPLDFEVEDDLLKCPPINNKRKKII 29 >KHN38710.1 hypothetical protein glysoja_008259 [Glycine soja] Length = 366 Score = 53.1 bits (126), Expect = 4e-06 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 4/48 (8%) Frame = +1 Query: 148 ILLWKPTLSK--HQLCLIDMDDPLDFEVEDDLLKPPPINN--KRKKVI 279 + + KP +S +L ++D +DPLDFEVEDDLLK PPINN KRKK+I Sbjct: 10 VFVCKPIVSNTNFELSVMDTNDPLDFEVEDDLLKCPPINNIIKRKKII 57 >XP_006591112.1 PREDICTED: uncharacterized protein LOC100804513 [Glycine max] XP_006591113.1 PREDICTED: uncharacterized protein LOC100804513 [Glycine max] KRH30571.1 hypothetical protein GLYMA_11G193400 [Glycine max] KRH30572.1 hypothetical protein GLYMA_11G193400 [Glycine max] Length = 485 Score = 53.1 bits (126), Expect = 4e-06 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 4/48 (8%) Frame = +1 Query: 148 ILLWKPTLSK--HQLCLIDMDDPLDFEVEDDLLKPPPINN--KRKKVI 279 + + KP +S +L ++D +DPLDFEVEDDLLK PPINN KRKK+I Sbjct: 10 VFVCKPIVSNTNFELSVMDTNDPLDFEVEDDLLKCPPINNIIKRKKII 57